KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_04610Help
Entry
AMBAS45_04610     CDS       T02253                                 

Definition
glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:amb00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:amb00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:amb00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:amb00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1076664..1077557
Genome map
AA seq 297 aa AA seqDB search
MSQVKKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSECVAAGLKEIILVTHAS
KNSIENHFDTSFELEATLEKRVKRQLLEEVQSICPKDVTIMHIRQGVANGLGHAVLCARP
LIGDAPFAVVLPDVIIDDAASNPKKDNLADMVAKFNTSRVSQVMVEQVPDEDISKFGIAD
LDGAAIAPGESAKIHKMVEKPPRDEAPSDLAVVGRYVLSEKIWDLLEFTPPGAGGEVQLT
DAIDALMKLEQVDAYYMKGKSHDCGSKLGYMKANVEYALRHPSLGDEFKEYLASVVK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggttaaaaaagcggtaatccctgtagcgggccttgggacgagaatgctccca
gcaacgaaagctattccaaaagagatgttgccagtggttgataagccattgatccaatac
gtggtaagcgaatgtgttgctgcaggactaaaagaaattatcctagtaacgcacgcgagt
aaaaacagtattgaaaaccactttgatacctcttttgaactagaagccacactagaaaag
cgtgtaaaacgccaactgttagaagaagttcagtcaatctgtccaaaagatgtaactatc
atgcatattcgccaaggcgttgctaatggacttgggcacgcagtactttgcgctcgacct
ttgattggcgatgcgccatttgcggtagtattacctgacgttatcattgatgatgcagca
agtaatcctaaaaaggataaccttgcagacatggttgccaaatttaacaccagccgagta
agtcaggtcatggttgagcaggtaccagacgaagatatctctaaatttggtatcgcagac
ctagacggtgcggcaattgcgccaggtgagtcagcgaagattcacaaaatggtagagaag
ccgcctcgcgacgaagcaccttctgaccttgctgttgtaggccgatacgttctgtcagaa
aaaatctgggatctgttagagttcacgcctccaggagcaggtggtgaagttcagcttact
gatgctattgacgcattgatgaaacttgaacaagttgatgcctactacatgaaaggtaag
agtcacgattgcggtagtaagttgggttacatgaaagctaacgttgaatatgcgttacgt
cacccatcgttaggcgacgaatttaaagaatacttagcgtctgttgttaaatag

DBGET integrated database retrieval system