KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_05910Help
Entry
AMBAS45_05910     CDS       T02253                                 

Gene name
asnB
Definition
(GenBank) asparagine synthetase B
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
amb00250  Alanine, aspartate and glutamate metabolism
amb01100  Metabolic pathways
amb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AMBAS45_05910 (asnB)
Enzymes [BR:amb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     AMBAS45_05910 (asnB)
Peptidases [BR:amb01002]
 Cysteine Peptidases
  Family C44
   AMBAS45_05910 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NARG2_C NAD_synthase
Motif
Other DBs
NCBI-ProteinID: AFT94660
UniProt: K0EGK4
Position
complement(1380517..1382187)
Genome map
AA seq 556 aa AA seqDB search
MCGIFGILDIKTDVSELRTQALDLSKLLRHRGPDWSGIWNNDNTILCHERLAIVDVDTGA
QPLISQNDKQILAVNGEIYNHKQLAANLDEPYPFKTRSDCEVILPLFQQKGIDFIDELEG
MFAFILYDEEQDAYLIARDHIGIIPLYTGYDEHGNFYVSSEMKALAGVCKTISEFPPGHY
LWSKEGKITKYYKRDWMEYDNVKDNTSNLEELRVAFEKAVKSHMMSDVPYAVLLSGGLDS
SLVSAVAAQYVAKRVEDEDKSDAWWPRLHSFAVGLEGAPDLKAAKKVADMIGTVHHEIHF
TIQEGLDAIRDVIYHLETYDTTTIRAATPMYLMTRKIKAMGIKMVLSGEGSDEIFGGYLY
FHKAPNAKEFHEETVRKLDRLHMFDCARANKATSAWGVEARVPFLDKNFIDVAMRLNPQD
KMCLDGKMEKWILRKAFDNGETLPAEVLWRQKEQFGDGVGYSWIDSIRDFVENEVTDQQL
ATAEFRFPVNTPDTKEGYYYRTIFESYFPQESAARCVPGGKSIACSTAEALEWDESFKNN
ADPSGRSMKGVHAGES
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattttcggtatccttgatatcaaaaccgatgtgtctgaactcagaacccaa
gccctcgatttatcaaaacttttgcgccaccgtggccctgactggtcgggtatctggaat
aatgacaataccattctttgtcacgaaagattggcgattgtcgatgttgatacaggggcg
cagcctcttatcagccaaaacgataaacaaattcttgccgttaacggcgagatttacaac
cacaagcaacttgctgctaatctagatgagccgtacccatttaaaacccgttctgattgc
gaagttattcttccgctttttcagcagaaaggcatcgactttatcgatgaactagagggt
atgtttgcgttcattctatacgatgaagaacaagacgcttaccttattgcccgcgaccat
attggtattattccgctttataccggttacgatgaacacggtaacttctatgtttcatct
gaaatgaaagcgttagcaggcgtatgtaagacaatcagtgagttccctcctggccactat
ctgtggagcaaagaaggtaaaatcaccaagtactacaaacgcgactggatggaatacgac
aacgtaaaagacaacaccagcaacctagaagagctacgtgtagcattcgagaaagctgtg
aagtcacacatgatgtctgacgttccatacgctgtacttctatcgggtggtcttgactct
tcactggtttcagctgtcgctgcgcagtacgttgcaaagcgcgttgaagacgaagacaag
tcagatgcatggtggcctcgcctgcacagttttgctgtaggtcttgaaggagcaccggat
ctcaaggcagcgaagaaagtggccgacatgattggcaccgtacaccatgaaattcacttt
actattcaagaaggtttagatgccatccgtgatgttatctatcacttggaaacctacgat
acaacaacgatccgcgccgctactccaatgtacttaatgacacgcaagattaaagcgatg
ggcattaaaatggtgctatcgggtgaaggttctgatgaaatttttggtggttacctgtat
ttccataaagcgccaaacgccaaagaattccacgaagaaacggtacgtaaacttgatcgt
ctacatatgtttgactgtgcgcgtgctaacaaagccacatcagcatggggtgtagaagct
cgtgtgccattcttagacaagaacttcattgacgtagctatgcgtttaaacccacaagac
aaaatgtgtctagatggaaaaatggagaaatggatccttcgtaaagcgtttgataacggc
gaaacccttccagcagaagtgctgtggcgtcaaaaagagcagtttggtgatggtgtaggt
tattcgtggattgattcaattcgcgatttcgttgaaaacgaagtgactgatcagcaactt
gcaacagcggaattccgcttcccagttaacacaccagacaccaaagaaggctactactac
cgcactattttcgagagctactttcctcaagaaagtgcggcgcgctgtgtgccaggcggt
aaatctattgcgtgtagtacagcagaagcacttgagtgggatgagagctttaaaaacaac
gcagatccttctggccgttcgatgaaaggcgtccacgcaggcgagtcttaa

DBGET integrated database retrieval system