KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_05940Help
Entry
AMBAS45_05940     CDS       T02253                                 

Definition
(GenBank) putative PAP (3,5 adenosine diphosphate) 3 phosphatase
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
amb00920  Sulfur metabolism
amb01100  Metabolic pathways
amb01120  Microbial metabolism in diverse environments
amb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AMBAS45_05940
Enzymes [BR:amb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     AMBAS45_05940
Transfer RNA biogenesis [BR:amb03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    AMBAS45_05940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P FBPase
Motif
Other DBs
NCBI-ProteinID: AFT94666
UniProt: K0EBN7
Position
complement(1389988..1390779)
Genome map
AA seq 263 aa AA seqDB search
MTQPLNSLAQKVLAIAKEAGDKIMAIYEKDFAIYEKQDTSPLTEADLAAHNVIVNALEAE
SDLPILSEESADISWEERKTWSSYWLVDPLDGTKEFIKKNGEFTVNIALIENGKPTMGVV
YAPALNKSYVGIVGEGAWTEVNGEFTAISARKHDGAEVWKVVGSRSHQSPEIQNLLAQLK
GETELVAMGSSLKLCLVAEGEAHLYPRLGPTSEWDTGAAHAVALAAGANVTVLDPENPLD
DNADALTYNQKESVLNPFFLVSA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcctttaaatagtcttgcacaaaaagtgctagctatcgccaaagaagccggc
gataagataatggccatttacgagaaagacttcgccatttatgaaaagcaggataccagc
ccgctaacagaagctgaccttgccgcacataacgtaatcgttaacgctcttgaagctgaa
tctgacctgccgattctttctgaagagtcagcagatatttcatgggaagagcgcaaaacg
tggtcgtcatactggctggtagacccgctagacggcactaaagagtttattaagaaaaac
ggtgagtttacggtaaatattgcacttatcgaaaacggtaaaccgaccatgggtgtggtt
tacgcgccagcactaaataaaagctatgtaggtattgttggtgaaggtgcgtggactgaa
gtaaatggcgaatttaccgctatttctgcgcgcaagcacgatggtgccgaagtgtggaaa
gtggtaggtagtcgttctcaccaaagcccagaaattcagaatttattggcacagcttaaa
ggtgaaaccgagcttgtggcgatgggtagctcactgaagctttgcttggtggctgagggc
gaagcacatctttaccctcgtttaggcccaacatctgaatgggatacgggagcagcgcac
gcagtcgcactagcagcaggcgcaaacgtaaccgtacttgaccctgaaaacccattagat
gacaacgctgacgctcttacgtacaaccaaaaagagtctgtgttaaacccctttttcctt
gtgagcgcataa

DBGET integrated database retrieval system