KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_06015Help
Entry
AMBAS45_06015     CDS       T02253                                 

Gene name
fadJ
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:5.1.2.3)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMBAS45_06015 (fadJ)
   01212 Fatty acid metabolism
    AMBAS45_06015 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    AMBAS45_06015 (fadJ)
   00650 Butanoate metabolism
    AMBAS45_06015 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    AMBAS45_06015 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    AMBAS45_06015 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AMBAS45_06015 (fadJ)
   00310 Lysine degradation
    AMBAS45_06015 (fadJ)
   00380 Tryptophan metabolism
    AMBAS45_06015 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AMBAS45_06015 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AMBAS45_06015 (fadJ)
   00281 Geraniol degradation
    AMBAS45_06015 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    AMBAS45_06015 (fadJ)
Enzymes [BR:amb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     AMBAS45_06015 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     AMBAS45_06015 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     AMBAS45_06015 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1409053..1411194
Genome map
AA seq 713 aa AA seqDB search
MTNEVQPTSGAFTLTKQDNGVAILSMDVPGESMNTLKAEFGDEISAMLDDIERDSSIKGV
VLTSGKPSSFVAGADITMLAACKTAEDATTIAAGGQAIFDRIENMKATFVAAIHGPALGG
GLELALACHYRVCTDSPSTQVGLPEVQLGLLPGSGGTQRLPRLIGIQQAMKMMLTGSPAR
AKQAKKYGIVDEVVPHSVLLKVAEQFALKRKPEREAPQKSVMDKVLEKTGPGRNMMFKKA
REATFAKTKGNYPAPGYIIDVIETGMNEGMKAGLKAEAEAFGKLVMTPESFQLRQIFFAT
TEMKKENGVEGVKPEKMKKVGVLGGGLMGGGIAYVTSTKAGVPVRIKDVRAEGIANAMKY
SYDILNKKVKKRFMRNSEMQKQLALLTGTLDYSGYQDADIVVEAVFEDLDLKQKMVADIE
ENCKESTIFASNTSSIPITQIAAKAARPENVIGLHYFSPVDKMPLAEVIAHDKTSDQVIS
STVEFAKKQGKTPVVVKDGAGFYVNRILAPYMNEAANLILDGEPIEHIDKSLVKFGFPVG
PVKLLDEVGIDVGTKIIPFLVEAFGERFTAPSAFDKVLADGRKGKKNQKGFYSYESKKPG
KEVDESIYELLGLSPSAKLSEKEVAERCVLMMLNEAARCLDEGVIRNARDGDIGAIFGIG
FPPFLGGPFRYMDTLGIKHVVARLNHYATAVGDKFAPAEVLVKMAENDQKFYS
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgaagttcagccaacatcaggcgcatttacgttaaccaagcaagataatggc
gttgctattcttagcatggacgtacctggcgagagcatgaatacgcttaaagctgagttt
ggcgatgagatatctgccatgcttgatgatattgaacgcgacagcagcatcaaaggtgtg
gtgttaacaagcggcaagccaagctcattcgtagcaggtgccgatatcaccatgctagca
gcgtgtaaaaccgcggaagatgccacaaccatagccgctggcggtcaagccattttcgat
agaattgagaacatgaaggctaccttcgttgcggctattcacggcccagcgttaggcggt
ggtttagagctagcattagcgtgtcattaccgtgtatgtaccgattcacctagtactcag
gtaggtctaccggaagtgcagcttggcttgttgccaggcagtggtggtactcagcgcctt
cctcgcctaattggcattcagcaagcgatgaaaatgatgctaactggctcacctgcacgt
gccaagcaagccaagaaatacggcattgttgatgaagttgttccgcatagcgtacttttg
aaagtggcggagcagtttgcccttaaacgcaaaccagaaagggaagcgccgcaaaagagt
gtgatggacaaagtgttagagaaaaccggcccgggccgtaacatgatgttcaaaaaagcg
cgcgaagcgacatttgccaaaacgaaaggtaattatccagcgccaggctacattattgat
gtaattgaaacgggcatgaacgaagggatgaaagcggggcttaaagccgaagctgaagcc
tttggtaagcttgttatgacgccggaatctttccagttacgtcagattttcttcgctacg
acagaaatgaagaaagaaaacggcgttgaaggtgttaaacctgaaaaaatgaagaaagtc
ggtgtgcttggcggtggtttaatgggcggtggtatcgcctatgtaacgtcgaccaaagcc
ggtgtacctgtccgtattaaagacgtgcgtgctgaaggcatagccaatgcaatgaaatat
agctatgacatcttaaacaaaaaggtgaagaagcgtttcatgcgcaatagtgaaatgcag
aaacagttagcgcttcttaccggtacgctagattatagcggctaccaagacgctgatatc
gtggttgaggcggttttcgaagatctagaccttaagcaaaaaatggtggcggatattgaa
gagaactgcaaagaaagcacgatcttcgcgtccaatacatcgtctattcctattacacaa
attgcagctaaggcagcacgtcctgaaaacgtgattggtctgcattacttctctccagta
gacaaaatgcctttggccgaagtaattgctcacgataaaacgtctgaccaagtcatttca
tcgacggttgaatttgctaaaaagcaaggcaaaacaccggttgttgttaaagacggtgcg
ggtttctacgtaaaccgtattttggcaccttacatgaatgaagcggcaaaccttattctt
gacggtgagcctattgagcatatcgataaatcgttggttaagttcggtttccctgtaggt
cctgtgaaactacttgatgaagtgggcattgacgttggcaccaagatcatcccatttctt
gtagaggcattcggtgagcgcttcactgcgccaagtgctttcgataaagtacttgcagac
ggcagaaagggtaagaaaaaccaaaaaggattttattcttatgaaagcaaaaaaccaggt
aaagaagtggatgaatcaatctacgaactacttgggctatcgccttctgcaaagctaagc
gaaaaagaagttgctgaacgctgtgtattaatgatgcttaatgaagcggcacgctgttta
gacgaaggcgttatccgcaatgcccgcgatggcgacattggtgctatcttcggaattggc
ttccctccattcttaggcggcccattccgctatatggatacactgggaattaaacatgtt
gttgctcgtttaaaccattatgctactgctgtaggtgataaatttgcacctgctgaagtg
ttagtaaaaatggcggaaaacgatcaaaagttttacagctaa

DBGET integrated database retrieval system