KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_06275Help
Entry
AMBAS45_06275     CDS       T02253                                 

Definition
Holliday junction DNA helicase motor protein
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:amb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AMBAS45_06275
Enzymes [BR:amb01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     AMBAS45_06275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1471555..1472175
Genome map
AA seq 206 aa AA seqDB search
MIGRIRGTLAEKQPPEILVDVAGVGYEIHMPMTSFYQLPAVGEEVVVYTHFVVREDAQLL
FGFADKMERGLFRELIKANGVGPKLGLAILSGMSASQFLASVQNEDVSALVSLPGIGKKT
AERLVVELKDRLAKFGKAQSIAVPPPSGDLLSTNTIVEVNDAREEAQSALIALGYKPAQA
SKLVDSVYKEGMESEALIRESLKAAI
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgattggacgaattcgcggtacgttggctgagaaacagcctccagaaattcttgtagat
gtagccggtgttggctacgaaattcacatgcctatgaccagtttctaccagcttcccgcg
gtgggtgaagaagtggtggtgtatacacactttgtggttcgtgaagacgcccagttactg
tttggttttgctgataaaatggaaagagggctttttagagaattgatcaaagccaatggt
gtaggtccaaagttaggccttgctattttatctggtatgtcggcaagccagttcttggca
agcgtacaaaacgaagatgtttctgcgctcgtcagcttaccgggtataggtaagaaaacc
gcagaacgcttagtggtagaacttaaagacagattggctaagtttggcaaggcgcagagt
attgctgtaccacccccaagtggcgacttgttatccaccaatactattgttgaagtgaac
gatgctcgggaagaagcgcaaagtgcgcttattgcactaggctataaacctgctcaagcg
agcaaactagtcgacagcgtatataaagagggcatggagagcgaagcccttattcgcgaa
tcattaaaagcggccatataa

DBGET integrated database retrieval system