KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_06765Help
Entry
AMBAS45_06765     CDS       T02253                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AMBAS45_06765
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMBAS45_06765
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AMBAS45_06765
Enzymes [BR:amb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     AMBAS45_06765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1575027..1576208)
Genome map
AA seq 393 aa AA seqDB search
MNQLDTKFGEFGGMYVPELLIPALDQLEKAFLDAKDDPAFNEEFLSLLKDYAGRPTSMTL
TRNLVSNPKVKLYLKREDLLHGGAHKTNQVLGQALLTKRMGKKEVIAETGAGQHGVATAL
ACALLGLKARIYMGAKDVERQAPNVFRMKLMGAEVIPVNAGSGTLKDAVNEAMRDWSANY
DKAHYLLGTAAGPHPFPTIVREYHRMIGEETRAQIMEKEGRLPDAVVACVGGGSNAIGMF
ADFIDEPSVRLVGVEPAGKGVHTKEHGATIVTGTKGILHGAYTFIMQDKEGQIEESYSVS
AGLDYPAVGPQHAYLHDIGRAEYVAATDEEALNAFQLLARKEGIIPALESSHALAHALNM
ADEAEEETIIVVNLSGRGDKDLAHVINILGDDL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagttagatacaaaatttggtgaatttggtggcatgtacgtgcccgagctactt
attccagcactagaccaactggaaaaagcatttttggatgccaaggacgacccagcgttc
aacgaagagtttttatctctgttaaaagactatgccggccgtccaacatcaatgacgtta
actcgcaaccttgtgagtaacccaaaggtaaaattatatctaaagcgtgaagacctactt
catggtggcgcacacaaaactaaccaggtattaggccaagcgctacttactaagcgcatg
ggtaaaaaagaagttattgccgaaactggcgcgggccagcacggtgttgcaaccgcttta
gcgtgtgcgttgcttgggcttaaagcacgtatttatatgggtgcaaaagacgttgaacgt
caagcgccaaacgtgttccgtatgaagcttatgggcgcagaggttattcctgtaaatgca
ggctctggtacccttaaagatgccgtaaacgaagctatgcgcgactggtcagcgaactat
gataaagcgcactatttgttaggcacagcagcgggtcctcaccccttcccgaccattgtt
cgtgaatatcaccgcatgattggtgaagagactcgcgctcaaattatggaaaaagaaggt
cgcttacctgacgctgtagtagcatgcgtgggcggaggctcaaatgctatcggtatgttt
gcagactttattgatgagccctctgtgcgcttagtgggcgttgagcctgcaggtaaaggc
gtgcacaccaaagagcacggcgcaactatcgtgacgggtacaaaaggtattcttcacggc
gcttacaccttcatcatgcaagacaaagaaggccagattgaagagagctactcagtatct
gctggtctcgactaccctgctgttggccctcagcatgcttaccttcacgacattggtcga
gcggaatacgttgccgctaccgacgaagaagcactgaatgcattccaattgcttgccagg
aaagaaggtattattccagcccttgaatcgtcgcatgctttagcgcacgcacttaatatg
gcggatgaagcggaagaagagaccatcatcgtagttaacttatcaggtcgtggcgacaaa
gatttagcgcacgttatcaacattttaggggacgatttataa

DBGET integrated database retrieval system