KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_09280Help
Entry
AMBAS45_09280     CDS       T02253                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMBAS45_09280
   01230 Biosynthesis of amino acids
    AMBAS45_09280
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMBAS45_09280
   00051 Fructose and mannose metabolism
    AMBAS45_09280
   00562 Inositol phosphate metabolism
    AMBAS45_09280
Enzymes [BR:amb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     AMBAS45_09280
Exosome [BR:amb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   AMBAS45_09280
  Exosomal proteins of bladder cancer cells
   AMBAS45_09280
  Exosomal proteins of melanoma cells
   AMBAS45_09280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2192188..2192931
Genome map
AA seq 247 aa AA seqDB search
MSKNLRKPFVAGNWKMNGNLALVAEFNQKLANVKADSEIVICAPSLLLHAFETHSFAIGA
QNVSHLNNGAHTGELSVEMLKEAGCGYAIVGHSERREDQGESSELVALKARQCVFSGVVP
IICVGEPLEVREAGDVESFVGEQLDALVSAMSVDELSKTVIAYEPIWAIGTGKTASPEQA
QEVHEFIRGYFNNVDAQLAQGLRILYGGSVKPDNAETLFAQKDVDGGLIGGASLKAEDFI
SICQAAN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaaaatcttagaaagccattcgtggctggcaactggaaaatgaacggaaatttg
gcattagttgctgaatttaatcaaaaactggcgaatgtaaaagctgattcggaaatcgta
atttgcgctccttcacttcttttacacgcatttgaaacccattcgtttgccattggtgct
caaaacgtaagtcatcttaataacggcgctcacactggtgagttgtcagttgaaatgctt
aaagaagcaggttgcggttacgcaattgttgggcattcagaaagacgagaagatcaaggc
gagtcaagcgaacttgttgcattaaaggcaaggcaatgtgttttttcaggtgtcgtaccc
atcatttgtgtaggtgagccacttgaagtgagagaagcaggtgatgttgaatcgtttgtt
ggcgagcaactagatgcactagttagcgccatgtcggtagacgaactcagcaaaactgtt
attgcatacgagccgatttgggcaattggtactggtaaaacagccagccctgagcaagca
caagaagtacacgaatttattcgcggctactttaataacgtagacgcacaattggctcaa
ggccttcgtattttgtacggtggtagtgttaagccagataatgctgaaaccctatttgca
cagaaagatgtagatggcggtttaattggcggagccagtttaaaagctgaagattttatt
tcaatttgccaagcggcaaactga

DBGET integrated database retrieval system