KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_09345Help
Entry
AMBAS45_09345     CDS       T02253                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:amb01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:amb00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2206777..2207886
Genome map
AA seq 369 aa AA seqDB search
MSHPNWKRVVIKVGSALISPNQQGCSSHYLLSIAQFIVRCRANGTQVVLVSSGSVAAGAH
LFPEQEKSDIAVKKAMAAAGQTEMIATWDRLFDFPSAQMLLTHADLRDRERYVSIRETIF
SLLDNNILPIVNENDTVTTDKLKVGDNDNLSAMVASAAEADALIICSDIDGLYDKNPHEH
DDAQLLKSVNTIDQSIYDMAGGAVKGGVGTGGMRTKIEAAEKAVSHGIDTYIINGFTELS
FNMLLAGENPGTHFKPHAKPMQENVHWMRHTSNAQGEVIVEGDFDASLAGDAEQLTSSEI
IDVKGEFSVGDTILVRKEDGTKLVKAKSNYSSCLLNFIANQENEEFAHEFEEKTGPIISD
QHIANLEKE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatccaaattggaaacgcgtagtcatcaaagtgggtagtgcattgatatcgccc
aaccaacaaggttgtagcagtcattaccttttgagcattgcgcaatttatcgtgcgatgc
agagccaacggtacacaagttgtactcgtgtcttctggttctgtcgcagcgggcgcgcac
ctgtttccagagcaagaaaagtcagatattgcagttaaaaaagcaatggcagcagcgggt
caaaccgaaatgattgccacatgggacagactgtttgattttccgtctgctcagatgctt
ttaacgcatgctgatttgcgagacagagagcgttacgtaagtatccgtgaaacgatattc
agtttattggataacaatatcctgcctatcgtgaacgagaacgacaccgttaccactgac
aaattgaaagtaggtgataacgataatttatcggccatggtggcgtctgcagctgaagca
gatgcgcttatcatctgttcagacattgatgggttgtacgataaaaacccgcatgaacac
gacgacgcgcaattgcttaaatcagttaataccattgatcaaagcatttatgacatggct
ggcggtgcggtaaaaggcggtgtaggcaccggtggtatgcgcactaaaattgaagcggcc
gaaaaagccgtttcgcatggtatagatacatatattattaacggctttactgaactgtcg
tttaatatgctgctagcaggtgaaaacccaggtacgcatttcaaacctcacgccaagcca
atgcaagagaatgtgcattggatgcgccatacgtcaaacgcgcagggcgaggtgatagta
gaaggggactttgacgcctctttagctggcgacgcagaacaactgacaagtagcgaaatt
attgacgtgaaaggtgagttctcggtaggcgacaccattctagtacgtaaagaagacggt
actaaactggtaaaagccaagtcgaactacagtagctgtttattgaatttcattgcgaat
caggaaaacgaagaattcgcccatgagtttgaggaaaaaactgggccaattatttctgat
cagcacatagcaaatctggagaaagaatga

DBGET integrated database retrieval system