KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_09665Help
Entry
AMBAS45_09665     CDS       T02253                                 

Definition
dihydrolipoyltranssuccinate transferase, component of the 2-oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMBAS45_09665
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMBAS45_09665
  Amino acid metabolism
   00310 Lysine degradation
    AMBAS45_09665
Enzymes [BR:amb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     AMBAS45_09665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2271136..2272647
Genome map
AA seq 503 aa AA seqDB search
MTIEIKVPVLPESVADATIATWHVKAGDAVKRDQNLVDIETDKVVLEVVAPADGTIGEIL
NEEGATVLGEQVIAKLEKGGAAAPAEAKTESKAKDDSKSDAAPAASGKTSDVKVPVLPES
VADATIATWHVAVGEAVSRDQNLVDIETDKVVLEVVAPADGSLAEIIAEEGATVTAEEVI
AKFVEGAASGASAPAASSESDDSDESSDALSPSVRRLLAEKGVDAAKVKGTGKNGRITKE
DVEKYLKGGDSSAEAAPAASESVSADLPTGNRTEKRVPMTRLRKTIANRLLEAKNSTAML
TTFNEVNMKPIMDLRKQYQDSFEKRHGIRLGFMSFYVKAVTEALKRFPEVNASIDGDDIV
YHNYFDVSIAVSTPRGLVTPVLKDTDTLGMAGVEKGIKELALKGRDGKLSLAELQGGNFT
ITNGGVFGSLMSTPIINPPQSAILGMHKIQDRPMAVNGKVEILPMMYLALSYDHRIIDGK
ESVGFLVTVKEMLEDPTRLLLDV
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgagataaaagttccggttctacctgagtcagttgccgatgccaccattgca
acctggcacgtaaaggccggtgacgcagttaaacgagaccagaacctggttgatattgaa
actgataaagtggttttagaagttgtggcgccagcggacggtacaattggtgagatccta
aacgaagagggtgcaactgttttaggcgagcaagttattgctaaactagaaaagggtggt
gctgctgcaccagctgaagctaaaacagaaagcaaagcgaaagacgattcaaaatcagat
gcggctccagcggcttctggaaaaacatctgatgttaaagtaccagtacttcctgaatct
gtagctgacgcgacaatcgcaacgtggcacgtagctgtaggtgaagcagtttctcgcgac
caaaacttggttgatatcgaaactgataaagtagtactagaagttgttgctcctgcagac
ggttctcttgctgaaattatcgcagaagagggcgccactgtaacagctgaagaagtgatt
gctaaatttgtagaaggtgcagcaagcggcgcttctgctcctgcagcgtcaagcgaaagc
gatgacagtgacgagagcagcgatgcgcttagtccttctgttcgtcgtttacttgcagaa
aaaggtgttgacgcagctaaagtgaaaggcactggcaaaaatggccgtatcactaaagaa
gatgtagagaaataccttaaaggcggcgacagctcagcggaggcagcgcctgctgcgtct
gaatctgtttctgctgacttaccaacgggtaatcgtaccgagaagcgtgttcctatgacg
cgtcttcgcaagacaattgctaaccgtcttcttgaagcgaagaactcaacggcaatgcta
acaacgtttaacgaagtaaacatgaagccaatcatggatcttcgtaagcagtaccaagac
agcttcgagaagcgtcacggtattcgccttggtttcatgtctttctacgtgaaagcggta
accgaagcccttaaacgtttccctgaagttaacgcgtctatcgacggtgatgacattgtt
tatcacaactacttcgatgtatcgattgctgtttctacaccacgtggccttgtaacacca
gtacttaaagatactgacacactaggcatggcaggtgttgaaaaaggaattaaggaacta
gcacttaaaggccgtgacggtaagctgtcattggctgaactacaaggtggtaatttcaca
atcaccaacggtggtgtgtttggttcactaatgtctacaccaatcattaacccgccacag
agcgctatcttgggtatgcataaaatccaagatcgcccaatggcggttaatggcaaagta
gaaattctaccaatgatgtacctagcgctttcttatgaccaccgtattatcgatggtaaa
gaatcagtaggtttcttggtaaccgttaaagagatgcttgaagatccaacacgtctactt
ctagacgtataa

DBGET integrated database retrieval system