KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_09670Help
Entry
AMBAS45_09670     CDS       T02253                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMBAS45_09670
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AMBAS45_09670
   00640 Propanoate metabolism
    AMBAS45_09670
   00660 C5-Branched dibasic acid metabolism
    AMBAS45_09670
Enzymes [BR:amb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AMBAS45_09670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2272800..2273966
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFKEYGLPVSEGYAADTAQGAVEAADRIGGNEWVVKCQVHAGGRGKAGGV
KLVKNKDDIRAFAENWLGKNLVTFQTDENGQPVSKILVESCTDIANELYLGAVVDRTTRR
VVFMASTEGGVEIETVAEETPEKILKAEIDPIVGPQPYQAREMAFALGLSGVQIKQFTQI
FLGLAKMFEELDVALIEINPLVIKTDGNLHCLDAKVGIDGNALYRQPKLKDMQDPSQEDA
REAHAAQWELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDDNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVEVPVVVRLEGTNAELGREV
LANSGLDIIAAESLTDAAQKVVAAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgaataccaaggtaagcagctattcaaagaatacggtttgcctgtttct
gaaggatacgcagcagacactgctcaaggtgctgtagaagccgctgaccgaattggcgga
aacgagtgggtagttaagtgtcaggtacacgcgggcggtcgcggtaaagctggcggtgta
aagctagttaaaaacaaagacgacattcgcgctttcgctgaaaactggcttggcaaaaat
ttggtgactttccagactgacgaaaacggtcagcctgtgagcaaaatcctagttgaatct
tgcacagatatcgctaacgagctttaccttggtgcagtagttgaccgtacaacccgtcgc
gttgtattcatggcatctactgaaggtggcgttgagattgaaactgttgcagaagaaact
ccagagaaaatccttaaagctgaaatcgacccaattgtaggtcctcagccttatcaagcg
cgcgaaatggcgtttgctctaggtctttctggcgtacaaatcaagcaattcactcaaatc
ttccttggcctagctaagatgtttgaagagcttgacgttgcgcttatcgaaatcaacccg
ctagttatcaaaactgacggtaacctacactgcctagacgcaaaagtaggtatcgatggt
aacgcgctttatcgtcagcctaagctgaaagatatgcaagatccttcacaagaagacgcg
cgtgaagctcatgctgctcagtgggaactaaactatgttgcgctagatggtaatgtaggt
tgtatggttaacggtgcaggcctggcaatgggtactatggacatcgtaaacctacacggt
ggcaagccagctaacttcctagacgttggtggcggcgcaactaaagagcgtgtagctgaa
gcattcaaaatcatcctttctgatgacaatgttaaagcggtattggttaacatcttcggt
ggtatcgttcgctgtgacatgattgcagaaggtatcattggtgcggttaaagaagttggc
gtagaagtacctgtagttgtacgtcttgaaggtaccaatgcagagcttggccgtgaagtt
ctagcgaactctggtctagatatcattgctgctgaatcgctaactgatgcagcgcagaaa
gttgttgctgcagcggagggcaaataa

DBGET integrated database retrieval system