KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_10730Help
Entry
AMBAS45_10730     CDS       T02253                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AMBAS45_10730
Enzymes [BR:amb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     AMBAS45_10730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2528442..2530196
Genome map
AA seq 584 aa AA seqDB search
MAWDHLHDKVKHHLESIYADVSLDVSYETLATELMNTIGIQQQTDIASPQSHHNYWDEDD
IIMITYGDSVIDEGERPLVTLNKFLHRYCKNTVNNVHILPFFPYSSDDGFSVIDYSTVNE
ALGSWDDIEVIAEDYGLMTDLVINHCSARSVWFDNFVRGEGPGSDFFFTADPSDDLSMVT
RPRVSPLLRETETANGTKHVWCTFSHDQVDFDFRNPKVLLAFIDIIKLYIDKGAKIFRLD
AVAFLWKIVGTNCINLFQTHEVIRLIRTLIEHVDPSIIIITETNIPNRENLTYFGNANEA
HAIYNFSLPPLLVNTLVTGDCTYLKSWMMSMPPAQNGTAYFNFIASHDGIGLRPAEGLLS
DEEISELVHTMQHFGGKVSWRASDHGQQKPYEINITLFDALQGTTKGPDKYQVDRFICAH
AIMLGMEGIPGIYIHSLLGTSNDYEKVANTGQNRSINRKRWDFNELEALLDSPFSQHHKV
LTRISQLIRIRKAQPAFHPNATQFTLQLGNQLFGYWRQSLDRKQSIFCISNISDEEQTIL
LSDINLIGTDNWIDLITRDEIALSNGFLQMKPYQVLWISNQDFE
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggcatgggaccatctccatgacaaagtaaaacaccatttagaaagcatttatgccgat
gtatcgctggacgtctcgtatgagacgctagcgactgagttaatgaacactataggcatt
caacagcaaacagatattgcttcacctcagtctcatcacaattattgggatgaagatgac
attatcatgattacctacggtgatagtgtcattgacgaaggggagcgcccgctggttacg
ttaaataagtttttgcaccgctactgcaagaataccgttaataacgttcacatcctgccc
ttctttccatacagctcagacgatgggttttcggttatcgattactctacggtgaatgaa
gcactggggtcatgggacgatattgaagtcattgctgaggattatggcttgatgaccgac
ttagttatcaatcactgctctgcaagaagcgtgtggtttgataactttgtgagaggtgaa
ggaccgggatctgactttttcttcacggcagacccatccgatgacctctccatggtaact
cgccctcgtgtgtcgcccttgctgcgagaaacggaaaccgccaacggtacaaagcatgta
tggtgcacgtttagtcacgaccaagttgactttgactttagaaaccccaaggtgttgtta
gcgtttatcgatatcatcaagctgtatattgataaaggcgctaaaatctttcgcttagac
gcagtggcatttctttggaaaattgtaggtacaaactgcattaatctattccaaacccac
gaagtcatacgtttgatccgaacgttgattgaacatgtggatccttccatcataatcatt
accgaaaccaatattcccaacagggaaaacctaacgtactttggtaatgctaacgaagcc
catgctatctacaacttttcgcttccgccgttacttgtaaatacattagtaacgggtgat
tgtacgtatttgaaaagctggatgatgagtatgccaccggcgcaaaacggcacagcctac
tttaactttatcgcttcgcacgatggtattggcttgcgtccggcggaaggcctactatca
gatgaagaaatttcagagcttgtgcatacaatgcagcactttggcggcaaggtgtcgtgg
cgcgcttctgatcacggtcagcaaaagccttacgagataaacatcaccctgttcgacgcg
ctgcaaggaaccaccaagggccctgataagtatcaagtggaccgatttatttgtgctcac
gccataatgttaggtatggaaggtataccaggaatttacattcacagtttactcggcaca
tccaacgattatgaaaaagtcgctaatacaggacaaaatcgttcaatcaacagaaaacgt
tgggactttaacgagttagaggctctgttggactcgcccttttcacagcaccataaagta
ctcactcgaatctcccagcttatacgtatacgtaaagcacagcctgcatttcatcctaac
gcaacgcagtttacattgcagcttggtaatcaattatttggctactggcgacaaagtctc
gatagaaagcaaagtattttctgtattagtaatatttcagacgaagaacaaacaattttg
ctgtctgacattaaccttattggcacagataattggattgatctcatcacccgtgacgag
atagccctttctaatggtttcttacaaatgaagccttatcaagtgctttggatcagcaac
caagattttgaatga

DBGET integrated database retrieval system