KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_10995Help
Entry
AMBAS45_10995     CDS       T02253                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    AMBAS45_10995
  Metabolism of other amino acids
   00480 Glutathione metabolism
    AMBAS45_10995
Enzymes [BR:amb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     AMBAS45_10995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2565740..2566294
Genome map
AA seq 184 aa AA seqDB search
MKAKDFVPALLALSFFTTPCFASECPSVLKFMKRKLNSQETVNLCNEYAGKTLLVVNTAS
YCGYTPQFEGLEALYSDYKDKDFVVLGFPSHDFNQEDSDEGKTAELCELTYGVKFPMFEP
ISVKGEDADPMYRMLKTATGKAPSWNFNKYLIDSSGKQITHYPSSTKPTDPAFIADIEAL
LKSE
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgaaagattttgtacctgcgttgcttgcgctcagctttttcacgactccttgc
tttgcgagcgagtgccccagcgtactaaagttcatgaagcgtaagctcaactcacaagaa
acggtgaatttgtgtaacgaatatgccggaaagacccttttagtggttaacacagccagc
tattgcggctacacgccacaatttgaaggtttagaagcgctatacagcgactataaagat
aaggactttgtcgtacttggtttcccttctcatgacttcaaccaagaagacagcgatgag
ggcaaaacggcagaactgtgtgaattgacttatggcgtaaagtttccgatgtttgaaccg
atatcggtaaaaggtgaagacgccgaccctatgtatagaatgctaaaaaccgccaccggc
aaagcgccatcatggaactttaataagtaccttattgacagctccggtaagcaaataacc
cactaccctagttcaacaaagcccactgatccggcttttatcgctgacatagaggcactc
ctcaaaagcgaatag

DBGET integrated database retrieval system