KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_11565Help
Entry
AMBAS45_11565     CDS       T02253                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:amb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AMBAS45_11565
Enzymes [BR:amb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     AMBAS45_11565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2692209..2694434)
Genome map
AA seq 741 aa AA seqDB search
MKSNQHSVPSFFDNLFGIEAIDKFVAKEFGFIDELEQEEQFIWAGILAYLSYMQRNGHSC
IYLKDIAGTTLFKEVVAEQEEVLAAEKNEHSSNAVAAASLTLVEQTEQEKAPKAGVDVPQ
LTPLLRIVKSAVVNEQVAQLFVYSNGKLYSRRYYEFEQEVARNVVERAALTPLSDKASEK
VKQLWPAIFPTETTDRQDWQQIAVAKSLMQRFCVINGGPGTGKTYTVLRLLLALQACDEN
LKIVLAAPTGKAQQRMTESIMNSIDGLRGKLDDTVLNNVPTDAVTLHRLLGLREHGVSTK
FNQHNQLSADVLIVDEASMVDLALMTRIVRALPDHARLYFIGDADQLPAVELGNVLEQLV
STETASFDDNANVPNGTNSAHSSLSLNNHDDGLSLGGVPSLMRQHIATLCPHLPLLPVDE
HAKSYVATLQAPQRFKGQVAKVATAIQRGDASGALAAITDKTGDNNESAGLGSNIDSNPG
SNTASRLQSGVHLWPEYQVSGRDLHQLAKESFLPIFDAGSAEEALNRLNVVRWLTPVRKG
AMGVEGLNNLVFDAIKHKIRKREGHFYQGQPIMIVKNHHPQRLSNGEVGVIWPDSKGKLY
AWFYQDSQASGQNGSSQKASANAGDSADKTLEQKQALRSISLSRVPQFETVYAMTIHKSQ
GSEFNHVVLILPKPDSEKAANLFHRGLVYTGLTRAKDGCLIISDNATFSHMVQRVDKRYS
GLSEAISLHLESTSNATPEVE
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcaatcaacactctgtaccgtcattttttgataacttgtttggcatcgaggcg
atcgacaaatttgtcgcaaaagaatttggctttattgatgaactggagcaagaagaacag
tttatttgggctgggatcttagcgtatttgtcgtatatgcagcgcaatggccacagctgt
atctatcttaaagacatagcgggtacgacgctttttaaagaggtagtcgcagaacaagag
gaagtcttggcggccgaaaaaaatgagcatagcagtaacgcggtggcggctgcttcactg
acactggttgaacaaaccgagcaggaaaaagcgcccaaagcaggtgtcgacgtgccacaa
ctaacaccgttacttagaattgtaaaaagcgcagtggttaacgagcaggtggctcaacta
tttgtctatagcaacggcaagctgtacagccgtcgctactatgagtttgaacaagaagta
gcacgaaatgttgtagaacgagcggcgcttacgcccttaagtgataaagctagcgaaaaa
gtaaagcaactttggccagcaatctttcctaccgaaacaaccgatcggcaagattggcag
caaatagcggtggcgaaaagcctaatgcagcgtttttgcgttataaacggtgggccagga
acaggtaaaacctatactgtattgcgcttattactggcgctacaggcttgcgatgaaaac
ttaaaaattgtgctggcggcgcctacaggtaaagcgcaacagcgtatgaccgaatctatc
atgaacagcatagacgggcttcgcggcaagttggacgacacagtgcttaacaacgtgcct
accgatgctgtgacgctacatagattactaggattgcgcgagcacggtgtatcgactaag
ttcaatcagcacaaccagttgtcagcagatgtactcattgtcgatgaggcaagtatggtc
gacttagcgctaatgacacgtatagtacgagcattgccagaccatgcacggctctatttc
attggagacgctgaccagcttcctgcggttgagctcggtaacgtgctagagcagctagtt
agtaccgagacggcaagttttgacgacaacgcgaatgtgccaaatggcacgaacagcgca
catagctcacttagtttaaacaatcatgacgacgggctttctttaggtggcgtgccatct
ttgatgcgtcagcacattgctacgctatgcccgcatttgcccctgttacctgttgatgag
cacgcaaaaagctatgtagcaactctgcaagcaccgcagcgcttcaaggggcaggtggct
aaagttgcaacggccatacagcgaggtgatgcaagcggtgcacttgccgctattaccgat
aagactggcgacaataacgaaagtgcgggtcttggttcaaatattgattcaaaccctggt
tcaaatacggcatcgcgcctacaatctggcgttcacttatggccagagtaccaagtaagt
ggccgtgatttacaccagttggccaaagaaagcttcttgcctatttttgatgctggcagt
gccgaagaagcgcttaatcgcctgaatgtggttaggtggctaaccccagttcgcaaagga
gcaatgggtgtagaagggctgaataatttggtgttcgatgccatcaagcacaagatcaga
aagcgggaaggccatttctatcaaggtcagcccattatgattgtaaagaatcatcatcct
caacgactatcaaacggtgaggttggtgtaatctggcctgacagcaaaggaaagctatat
gcgtggttttaccaggatagccaagcttcaggtcaaaacggttcaagtcagaaagcttcg
gcaaatgcgggagacagtgctgacaagacgctagaacaaaaacaagcgttgcgcagcata
tcgctatcaagagtaccgcagtttgaaactgtgtatgccatgaccatacataaatctcag
ggctctgagtttaatcatgttgtacttattcttcctaagcctgatagcgagaaagccgcc
aatttatttcatcgaggcctagtgtacacagggttaacccgtgctaaagacggctgctta
atcatctctgacaacgctacatttagccacatggttcaacgggtggataagcgttattcc
gggctgtctgaagcgattagcctgcacctagagagcacatcaaacgccaccccagaggtt
gaatag

DBGET integrated database retrieval system