KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_11565Help
Entry
AMBAS45_11565     CDS       T02253                                 

Definition
(GenBank) exodeoxyribonuclease V subunit alpha
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
amb03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:amb00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AMBAS45_11565
Enzymes [BR:amb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     AMBAS45_11565
DNA repair and recombination proteins [BR:amb03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AMBAS45_11565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 AAA_11 Helicase_RecD DUF2075 UvrD_C AAA_22 PhoH UvrD-helicase ResIII Flavi_DEAD IstB_IS21 TrwB_AAD_bind AAA_12
Motif
Other DBs
NCBI-ProteinID: AFT95778
UniProt: K0EGS8
Position
complement(2692209..2694434)
Genome map
AA seq 741 aa AA seqDB search
MKSNQHSVPSFFDNLFGIEAIDKFVAKEFGFIDELEQEEQFIWAGILAYLSYMQRNGHSC
IYLKDIAGTTLFKEVVAEQEEVLAAEKNEHSSNAVAAASLTLVEQTEQEKAPKAGVDVPQ
LTPLLRIVKSAVVNEQVAQLFVYSNGKLYSRRYYEFEQEVARNVVERAALTPLSDKASEK
VKQLWPAIFPTETTDRQDWQQIAVAKSLMQRFCVINGGPGTGKTYTVLRLLLALQACDEN
LKIVLAAPTGKAQQRMTESIMNSIDGLRGKLDDTVLNNVPTDAVTLHRLLGLREHGVSTK
FNQHNQLSADVLIVDEASMVDLALMTRIVRALPDHARLYFIGDADQLPAVELGNVLEQLV
STETASFDDNANVPNGTNSAHSSLSLNNHDDGLSLGGVPSLMRQHIATLCPHLPLLPVDE
HAKSYVATLQAPQRFKGQVAKVATAIQRGDASGALAAITDKTGDNNESAGLGSNIDSNPG
SNTASRLQSGVHLWPEYQVSGRDLHQLAKESFLPIFDAGSAEEALNRLNVVRWLTPVRKG
AMGVEGLNNLVFDAIKHKIRKREGHFYQGQPIMIVKNHHPQRLSNGEVGVIWPDSKGKLY
AWFYQDSQASGQNGSSQKASANAGDSADKTLEQKQALRSISLSRVPQFETVYAMTIHKSQ
GSEFNHVVLILPKPDSEKAANLFHRGLVYTGLTRAKDGCLIISDNATFSHMVQRVDKRYS
GLSEAISLHLESTSNATPEVE
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcaatcaacactctgtaccgtcattttttgataacttgtttggcatcgaggcg
atcgacaaatttgtcgcaaaagaatttggctttattgatgaactggagcaagaagaacag
tttatttgggctgggatcttagcgtatttgtcgtatatgcagcgcaatggccacagctgt
atctatcttaaagacatagcgggtacgacgctttttaaagaggtagtcgcagaacaagag
gaagtcttggcggccgaaaaaaatgagcatagcagtaacgcggtggcggctgcttcactg
acactggttgaacaaaccgagcaggaaaaagcgcccaaagcaggtgtcgacgtgccacaa
ctaacaccgttacttagaattgtaaaaagcgcagtggttaacgagcaggtggctcaacta
tttgtctatagcaacggcaagctgtacagccgtcgctactatgagtttgaacaagaagta
gcacgaaatgttgtagaacgagcggcgcttacgcccttaagtgataaagctagcgaaaaa
gtaaagcaactttggccagcaatctttcctaccgaaacaaccgatcggcaagattggcag
caaatagcggtggcgaaaagcctaatgcagcgtttttgcgttataaacggtgggccagga
acaggtaaaacctatactgtattgcgcttattactggcgctacaggcttgcgatgaaaac
ttaaaaattgtgctggcggcgcctacaggtaaagcgcaacagcgtatgaccgaatctatc
atgaacagcatagacgggcttcgcggcaagttggacgacacagtgcttaacaacgtgcct
accgatgctgtgacgctacatagattactaggattgcgcgagcacggtgtatcgactaag
ttcaatcagcacaaccagttgtcagcagatgtactcattgtcgatgaggcaagtatggtc
gacttagcgctaatgacacgtatagtacgagcattgccagaccatgcacggctctatttc
attggagacgctgaccagcttcctgcggttgagctcggtaacgtgctagagcagctagtt
agtaccgagacggcaagttttgacgacaacgcgaatgtgccaaatggcacgaacagcgca
catagctcacttagtttaaacaatcatgacgacgggctttctttaggtggcgtgccatct
ttgatgcgtcagcacattgctacgctatgcccgcatttgcccctgttacctgttgatgag
cacgcaaaaagctatgtagcaactctgcaagcaccgcagcgcttcaaggggcaggtggct
aaagttgcaacggccatacagcgaggtgatgcaagcggtgcacttgccgctattaccgat
aagactggcgacaataacgaaagtgcgggtcttggttcaaatattgattcaaaccctggt
tcaaatacggcatcgcgcctacaatctggcgttcacttatggccagagtaccaagtaagt
ggccgtgatttacaccagttggccaaagaaagcttcttgcctatttttgatgctggcagt
gccgaagaagcgcttaatcgcctgaatgtggttaggtggctaaccccagttcgcaaagga
gcaatgggtgtagaagggctgaataatttggtgttcgatgccatcaagcacaagatcaga
aagcgggaaggccatttctatcaaggtcagcccattatgattgtaaagaatcatcatcct
caacgactatcaaacggtgaggttggtgtaatctggcctgacagcaaaggaaagctatat
gcgtggttttaccaggatagccaagcttcaggtcaaaacggttcaagtcagaaagcttcg
gcaaatgcgggagacagtgctgacaagacgctagaacaaaaacaagcgttgcgcagcata
tcgctatcaagagtaccgcagtttgaaactgtgtatgccatgaccatacataaatctcag
ggctctgagtttaatcatgttgtacttattcttcctaagcctgatagcgagaaagccgcc
aatttatttcatcgaggcctagtgtacacagggttaacccgtgctaaagacggctgctta
atcatctctgacaacgctacatttagccacatggttcaacgggtggataagcgttattcc
gggctgtctgaagcgattagcctgcacctagagagcacatcaaacgccaccccagaggtt
gaatag

DBGET integrated database retrieval system