KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_11775Help
Entry
AMBAS45_11775     CDS       T02253                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AMBAS45_11775
Enzymes [BR:amb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     AMBAS45_11775
Exosome [BR:amb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AMBAS45_11775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2742842..2745025)
Genome map
AA seq 727 aa AA seqDB search
MQLAQQFEQVLCSQPFSHLGVVKNQQKSVLRVWRPNVSRITIEWENAALANVTVTSKNGL
FETPLPKEYQGEVYRVIAEGLNDDKGYIDPYQFSEQAYHAVHYIDSKPSNLYEQAGAQLL
TLTSSKGDAIKGVRFCVFAPNASTVSLIGDFNQWDGRTHPMEKTSMGYWVLFVPELAEGE
RYKYHIKDSHGHDLPHKADPLGFSAEQYPSHASKIYNHNNYEWNDSAWMEKRKGNKYNSP
MSIYEVHLGSWKRPGIETDARYLTYKALADDLISYVSDMGYTHVELLPISEFPFDGSWGY
QPVGMFAPTSRFGNPDEFKYFVDKAHQAGIGVIIDWVPAHFPEDGHGLARFDGSCVYEYE
DPRKGWHPDWNSCIYDFGKDTVRQFLVANALFWLDKFHVDGLRVDAVASMLYLDYSRNDG
EWIPNVDGGNENYEAISLLKWMNEEVYKHFPDAMTIAEESTSFPKVSRPVFDGGLGFGFK
WNMGWMHDSLHYIAKDPAYRNYHHGDITFSMVYAFDENFVLPISHDEVVHGKGSMLHKMP
GDEWQQAANLRCYAGFMYGHPGKKLNFMGNELAQAREWNHDSSLDWHLLDYEKHKGIQAL
YKALNHLYTSTPALYEQDHEPGGFAWLDHNNADQSVVSFVRMSKDAKQKVYVVSNFTPVP
RHNFRIGVDDACSLTLALNTDDGAYWGSDYDVASTVNTQTIPWNERTHSAEITLPPLATV
FYVANVD
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgcaattagcgcagcagtttgaacaggtattatgttctcagccgttttcccatttaggt
gtagttaaaaatcagcagaagtcggtacttcgcgtttggcgtcctaatgtcagcaggata
acgattgaatgggagaatgcagcgctagcaaatgtaaccgttacctccaaaaatggtctt
tttgaaacaccactgcctaaagaatatcagggtgaggtttatcgcgttatcgctgaaggt
ttgaatgacgataagggctatatcgatccttatcaattctccgagcaggcgtatcatgcg
gtacattacatcgatagcaagccttcaaacttgtacgagcaagcgggcgcgcaactttta
acactcacttcttcaaaaggcgatgcgataaaaggtgtcaggttctgcgttttcgcgccc
aatgcaagcacggtgtcgctcattggcgatttcaatcagtgggatggccgcacacatcct
atggaaaagacctctatgggatactgggtactgtttgtgccagaactcgcagagggagag
cgctacaagtatcacattaaagattcacacggccacgacctaccgcacaaggctgaccca
cttggcttcagtgcagagcagtatccttctcatgcttcgaaaatttacaaccacaataac
tatgagtggaatgatagtgcatggatggaaaagcgaaaggggaacaaatacaacagccca
atgagcatttatgaagtgcaccttggctcttggaagcgcccgggtattgaaactgatgcg
cgctatcttacttataaagcgctggccgatgacttaataagctacgtcagcgatatgggt
tacactcacgttgaattgttgcctatttccgagtttcctttcgacggttcgtggggttat
cagcctgtgggaatgttcgcaccaacgagtagatttggaaacccagatgaatttaaatac
tttgttgataaggctcaccaagcaggtataggcgtaattatcgactgggtacctgcccat
ttcccggaagacggccatggcttggcgcgatttgatggttcatgtgtttatgaatatgaa
gatccgagaaaaggctggcatccggattggaattcttgcatttacgatttcggcaaagac
acagttcgtcaatttttagttgcaaacgcactgttttggctcgacaaatttcacgttgat
ggactcagggttgatgcagtggcatccatgctttatctcgactattcacgcaatgacgga
gagtggatcccgaatgtggatggtggcaacgaaaactacgaagccatcagcttactgaaa
tggatgaatgaagaagtgtacaagcacttcccagacgccatgactattgccgaagaatca
acgtcatttcccaaggtttctcgtccagtatttgatggcggcttggggttcgggtttaag
tggaacatggggtggatgcacgactcattgcattacatcgctaaagaccccgcctatcgc
aactatcaccatggcgatattacctttagcatggtctacgcgtttgacgaaaactttgtg
ctgcctatctcgcacgatgaagtggtacacggcaaaggcagtatgctgcataaaatgcct
ggcgatgaatggcagcaagccgctaacctgcgttgttacgcgggctttatgtacggtcac
cccggcaagaagcttaactttatggggaacgagcttgcgcaggcacgagaatggaaccat
gacagtagtttagactggcacttgctcgattacgaaaaacacaaaggcattcaagcgctt
tataaggcgctcaaccacctctatacgtctacgccagcgctttacgagcaagaccacgaa
ccagggggctttgcttggctcgaccacaataatgcagaccaaagcgtagtttcatttgtt
cgcatgtcaaaagatgcgaagcaaaaagtttatgtggtatctaattttacgcctgtccca
cgtcataacttcagaataggcgtagatgatgcatgttcgctaacgctagcactaaacact
gatgatggcgcatattggggtagtgactacgacgttgcttctactgttaatacgcaaacc
ataccttggaatgagcgtactcactctgcagaaatcacgttaccgccgctagccacggta
ttttatgttgccaatgtggattaa

DBGET integrated database retrieval system