KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_11780Help
Entry
AMBAS45_11780     CDS       T02253                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:amb00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2745184..2747382)
Genome map
AA seq 732 aa AA seqDB search
MTQQLLQQLVEMRGIETQYVDAWGKPATIAESSKAKLLNTLGYDTSSDEKIQSQITQDIK
SVWLSPLNPVQVVRNTQEINLAVRLPIELVNDDHTLTVTCENGDVLTHQFTPVDQEMTTM
AHIDDIEFHEYVVTLPLDLPLGYHDVALSADDDEFARSRLIVAPEACYTPNEIKEGKKIW
GLSVQLYCVRSEKNWGIGDFSDLALLIEKAAGVGADFIGLNPIHALYPANPNACSPYGPS
SRRWLNYLYIDVTAIDGYDDASVQTVVNSDEFKATLEHARNVEHVDYEAVAHVKLAALKA
VFDVYDAKYLRKSTKQNKAFKAFVQAGGESLDMLAVYDALQSHLKAEGKDSWGWPVFPQE
YKDYHNPAVAKFKSANEQDVKFYLFLQWIAAQQLELASSKATDAGMTIGLYRDLAVGVSE
GSAEIWGNKDLYCTGASVGAPPDILGPLGQNWGLPPMDPRKLYEQGYQPIIDLFASNMAS
SGSLRIDHVMALLRLWWVVKGDNAKDGGYVYYPVDDLLGILALESHRNQSLVIGEDLGTV
PEEIRSKLADNGVYSYRVFFFEQAEDGGFFSPSHYPVQSMSTLTTHDMPTLIGYWHCLDL
ELGKEIGLYPTEEILQTLYADRHENKQAILDTLHGHGSIGDNVGRDVNHTGMNRELNNGM
QVHMAGGSSALLSLQLEDWLEMDKPVNIPGTFDEYPNWRRKLTENIESMFDRHDINELAS
KLTHARKQASQG
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacaacttctgcaacaactggttgaaatgcggggaattgaaacccaatacgtc
gacgcatggggaaagccagcaaccatcgcagaatcaagtaaagcaaaactgcttaacaca
cttggctatgacaccagcagtgatgaaaaaattcagtcacaaattacacaagatataaag
tcggtatggttgtcgccgttaaatcctgttcaagtagttcgcaatacccaagaaattaat
ctagcagttcgtttacctatcgagttagtgaatgatgatcacacgctcacggtcacctgt
gaaaatggtgacgtgctcactcatcaatttacgccagttgaccaagaaatgacgacgatg
gcgcatatcgacgatatagagtttcatgaatacgtagtaacactgcctttggatttgccc
cttggttatcacgatgtagccttaagcgctgatgacgatgagtttgcgcgttctcgctta
attgtggctccagaagcgtgctacacgccaaacgaaattaaagaaggcaaaaaaatatgg
ggcttaagcgttcaactttactgcgttcgcagtgaaaagaactgggggattggtgatttt
tctgatttagctctgctaattgaaaaagccgctggtgtgggcgcagactttatcggactt
aatcctattcatgcgctttatcctgcaaatcccaacgcgtgctcgccttatgggccaagc
tcacgtcgctggcttaattatttgtatatcgatgtgactgccattgacggctatgacgac
gcatcagtacaaaccgtagttaatagtgatgaatttaaagccacgcttgaacatgcacgt
aacgtagaacatgtagactatgaagcggtagcccatgtgaaattggctgcgcttaaagca
gtatttgatgtttacgatgccaaataccttcgtaaaagcacaaaacaaaataaagcgttt
aaagccttcgtacaagcgggcggtgaaagcttagatatgttagcggtgtacgacgccctg
caatcgcacttgaaagctgaaggcaaagacagctggggatggccggtatttccacaagaa
tacaaagattatcacaacccagctgtagctaagtttaagagcgctaacgagcaagatgtc
aaattctaccttttccttcagtggattgcggcgcagcagcttgaacttgcaagtagtaaa
gctacagatgcgggtatgactattgggctttatcgcgacttggcggtaggggtgagcgaa
ggcagtgcggaaatttggggtaacaaagacctatactgcacaggcgcaagcgtaggtgct
ccaccagatatcttaggcccactaggccagaactgggggttgccgcctatggaccctcgt
aagctgtatgaacagggttaccaacctattattgacttgtttgcgtctaacatggcatcg
tcgggttcactgcgcatcgatcacgttatggcgttgctgcgtttatggtgggttgtgaaa
ggcgataacgctaaagatggcggctatgtttattaccctgtagatgatttgcttggtatt
ttagcgctagaaagtcaccgtaatcagagcctggttattggtgaagacttgggtactgta
ccagaagaaattcgcagtaagcttgctgataatggcgtgtactcataccgcgtatttttc
ttcgaacaagcggaagacggtggtttcttctcacctagccattaccctgttcagtctatg
tcaacgttgactactcacgatatgccaacgctgattggttactggcactgtttagattta
gagctaggcaaagaaatagggctttatccaacagaagaaatccttcaaacgctttatgcg
gatcgtcatgaaaataaacaggcaatacttgatacgttgcacggccacggttcaattggc
gacaatgtaggccgcgatgttaatcatacgggtatgaatcgcgaactgaataacggtatg
caggtgcatatggcaggtggctcgagcgcattattgagcctgcaattggaagactggtta
gagatggataagccggtcaatattcctggtacttttgacgagtatccaaactggcgaaga
aaactcacagagaatattgagtcgatgttcgatagacatgatataaatgagttggcgtct
aaacttactcatgccagaaagcaagcaagtcagggttaa

DBGET integrated database retrieval system