KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_11960Help
Entry
AMBAS45_11960     CDS       T02253                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AMBAS45_11960
   00500 Starch and sucrose metabolism
    AMBAS45_11960
Enzymes [BR:amb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     AMBAS45_11960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2791408..2792610
Genome map
AA seq 400 aa AA seqDB search
MEFNKARVSLSLAFVLLAGILFSGLSAAMPATTDVVVAKSHDSDDESDVSKDALPHFNSV
SQAVAYIASHKPQKDKVWTVFINEGIYRERVVINVDNVHFVGQSQETTTIVFNRYAGQQV
AENSQEKWGTRRTATVEILGDNITLENITITNDFDYPGNEVKAKDDPTRLSGTQAVALKT
DVNSDRTYLKNVALWGYQDTLYLKGDRALIEGGTIAGHIDFIFGDGTAFFESVSIVSRTR
YSGGDSEGLTGYITAPSTHLQRPYGLTFNNCRLEREHGVPDESVALGRPWHPTTTFSDGR
YANPYAVGKTTFINTYMAGHIIQKRWTTMGGTTPSGTKRPFNPHTEARFSEYQSHGEGAP
KAVSSPAINSHFLNDKNAAFYTKEAVLRGWVPNNIPNDIK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggaatttaataaagcacgtgtcagtcttagtttagcctttgtgttgctggcaggtata
cttttcagtggattaagcgcggcaatgccagcaacgacggatgttgtggtagctaaatca
catgacagtgacgatgagagtgacgtaagtaaggacgctttacctcattttaactctgtg
tcccaagctgttgcttatatcgcgtctcacaagccacaaaaagataaagtatggaccgtc
tttattaacgaaggcatttatcgagagcgtgtcgtcataaacgttgataatgttcacttt
gtgggccagtcgcaagaaacaacgactatcgttttcaatcgatatgcaggtcaacaagtc
gcagagaattctcaagaaaaatggggaactcgtcgcactgccactgtggagattttaggt
gataatatcactctggaaaatatcactatcaccaatgattttgattatcccggtaacgag
gtcaaagcaaaagacgaccctactcgattatcaggtacgcaggcagtagcgcttaaaacc
gatgtgaactcagatcgcacttaccttaaaaatgtcgcactctggggttaccaagatacc
ctctatttaaaaggtgaccgcgctctgattgaaggcggaacaatagcaggacatattgac
tttatttttggtgatggcaccgcgttttttgaaagcgtttctattgtttcccgtacacgt
tattctggcggtgatagcgaaggactaacaggctacattaccgccccaagcactcattta
cagcgcccttatggattaacgttcaataactgtaggcttgaaagagaacacggcgttcca
gatgaaagcgtggcactgggaaggccttggcatcctacaaccaccttttcagatggccga
tatgcaaacccttacgctgtaggtaaaacaacgtttatcaacacctatatggcaggtcat
atcatccaaaagcgctggactactatgggtggaactacgccatcaggtacaaagagacca
tttaatccccacacagaagcaagattttccgagtaccaatctcatggagaaggtgcacct
aaagcagtctcctcaccagcaataaactctcattttctgaatgataaaaacgcggctttt
tacactaaagaggcggtattgcgaggctgggtgcctaataacattccgaacgatattaaa
tag

DBGET integrated database retrieval system