KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_12160Help
Entry
AMBAS45_12160     CDS       T02253                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AMBAS45_12160
Enzymes [BR:amb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     AMBAS45_12160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2841483..2842979
Genome map
AA seq 498 aa AA seqDB search
MSIRNGVQLITYADRLGDGNIESLTSILQGPLGGLFTGVHILPFYYPYDGEDAGFDPIDH
TLVDERLGDWENVKKLGESVDIMADLIVNHMSGQSEAFKDVLKNGRESSYWPLFLTKEDI
FKGNDQAQIDEQIAQVFRPRPTPFFSDYEVGTETGNPETVPFWTTFTSNQIDIDVESQLG
KDYLSSILQSFTESNVDLIRLDAAGYAIKRAGSNCFMLEETFEFIEELSNRARGMGMQCL
VEIHSHYQTQIDIAARCDSVYDFALPPLVLHTLFSKNAEALAYWLSISPRNCFTVLDTHD
GIDIVDVGASGDKPGLLTADAINSLVDQIHENSNGESKKATGAAANNVDLYQVNCTYYDA
LGKDDFAYLVARAIQFFSPGIPQVYYGGLLAAHNDMALLAKTNVGRDINRPYLSSSMVKD
AVEKPVVKGLMKLITLRNESDAFNGVFDVSYINNVFVLSWKNGNHAASLNVNFSTMDATI
HTVDNCEESVLSINSLLA
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtctatacgcaatggcgttcaactaatcacctatgcagaccgactaggcgatggcaac
atcgagagtctaacaagcatacttcagggcccgttaggtggcctgtttacgggtgttcac
atccttcctttttactacccttacgatggtgaagacgcgggtttcgatcctatcgatcat
accttggtcgatgagcgcttgggcgattgggagaacgtaaaaaagcttggcgaatcggta
gatatcatggccgacctcattgtcaaccatatgtcggggcaaagtgaagcgttcaaagac
gtgctgaaaaacgggcgcgaatcgagttattggccgctgttcttaaccaaggaagatatt
tttaagggcaacgatcaagcacaaattgacgaacaaatagcacaagtgttccgccctcga
cccacaccgtttttcagcgattacgaggtaggcacagagactggtaaccctgaaaccgtg
ccgttctggacaacttttacctctaatcaaattgatattgatgtggagtcacagttaggc
aaagactacctatcttctattcttcagtcgtttactgaaagtaatgttgatcttattcgc
ttagatgcggcgggctatgcaattaaacgcgcaggttcgaactgctttatgcttgaagaa
accttcgaatttatcgaagaattatcaaaccgcgcacgtggtatgggcatgcagtgttta
gtcgaaatacacagtcactatcaaactcaaattgatattgctgcgcgttgcgacagtgtt
tacgacttcgctttacctccgctggtactacacaccttgttctctaaaaatgcagaagca
ttggcatactggctgtcaatttcgccacgtaactgctttaccgtgcttgatactcacgat
ggcatcgacattgttgacgtgggcgcgagtggtgacaaaccaggtctgcttaccgcagat
gcgattaattcgctcgttgaccaaatacatgaaaattccaatggcgagtctaaaaaagcc
accggcgctgcggcaaataatgtagacctttaccaggtaaactgcacatattacgatgcg
ttaggtaaagatgacttcgcctatttggttgcacgcgccattcaattttttagcccgggt
atccctcaagtttattacggtggcttgcttgctgcgcacaatgatatggcgttacttgct
aaaaccaatgttggccgcgacattaaccgcccttacctgtcatcttcgatggttaaagat
gccgttgaaaagccggttgtcaaaggcttaatgaagcttattacactgagaaacgaaagc
gatgcttttaacggtgtatttgacgtgagttacatcaacaacgtattcgtgctttcgtgg
aaaaacggcaaccatgcggcgtcactaaacgtgaacttcagcacaatggatgcaactatt
catacggtggataattgtgaagaaagcgtgttgtcaatcaactcactacttgcttaa

DBGET integrated database retrieval system