KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_13295Help
Entry
AMBAS45_13295     CDS       T02253                                 

Definition
Outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AMBAS45_13295
   00565 Ether lipid metabolism
    AMBAS45_13295
   00590 Arachidonic acid metabolism
    AMBAS45_13295
   00591 Linoleic acid metabolism
    AMBAS45_13295
   00592 alpha-Linolenic acid metabolism
    AMBAS45_13295
Enzymes [BR:amb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     AMBAS45_13295
    3.1.1.32  phospholipase A1
     AMBAS45_13295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3102967..3103983
Genome map
AA seq 338 aa AA seqDB search
MSVLKPFVLLAAFAACTPVCAQQSREVVSEQASSLENSEQERTVENEENQSSQDESGIEV
IDIIKRDTITESALDNRLEGDKEALDNVFAITQHRQNYLLPITYVSNPSSVASEELTNEN
IDNKEAKFQVSAKLPLYLEDTGFDGVYFGFTLTSFWQLYNSEASKPFRETNYEPEVFWQE
TADYSVLGYKFNTFQVGFNHMSNGQSGLRSRSWNRIFASIVFSDDDDIYYLKTWYRIPED
EKTDPLDPTGDDNPDIQDYYGRMELGYGRKIGAFKVLALLRNNLDVDENRGSIQLDFTYP
ISDRYEVLLQYFNGYGDSLIDYNRSQERIGIGFQLHFL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgtgttaaagccttttgtattattggcagcatttgctgcttgtacgcctgtgtgc
gctcaacaatcacgagaagtggtaagcgaacaagcgtcatctttagaaaatagtgaacaa
gagcgcactgttgaaaatgaagaaaatcaatcgtcacaggatgaaagcggtattgaagtt
atcgatatcatcaagcgtgacaccatcacggaaagtgcactggataaccgattagaaggc
gataaagaagcactggataatgtgtttgctatcactcagcatagacaaaactatctactt
ccaatcacttacgtttccaacccaagctctgtggccagtgaagaactcacaaacgagaac
atagacaataaagaagcaaaatttcaggtaagcgctaagctgccgctttatttggaagat
acaggattcgacggtgtttactttggctttacgctaacctctttctggcagctttataac
agcgaagcgtcgaagccgtttcgcgagaccaattacgaaccagaagtcttttggcaagaa
acagccgattattccgtacttggctacaaatttaatacctttcaagttggtttcaatcat
atgtctaacggtcaaagcgggctgcgctctcgaagctggaaccgtatatttgcctctatt
gtctttagcgacgatgacgatatctactacctaaagacgtggtaccgtattcctgaagac
gagaaaacagacccgcttgatcctaccggcgacgataaccctgatatacaagactattac
ggtagaatggaacttggttatggaaggaaaattggcgcgtttaaagtactggcgctttta
cgaaacaacctcgacgtagatgagaaccgaggcagcatccagctagacttcacctaccct
atctctgaccgctatgaagtcttgcttcaatacttcaatggctatggcgattcgcttatc
gactataaccgctcacaagaacgtattggtatcggttttcagctgcactttttgtaa

DBGET integrated database retrieval system