KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_13585Help
Entry
AMBAS45_13585     CDS       T02253                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMBAS45_13585
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    AMBAS45_13585
   00630 Glyoxylate and dicarboxylate metabolism
    AMBAS45_13585
Enzymes [BR:amb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     AMBAS45_13585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3166523..3168718
Genome map
AA seq 731 aa AA seqDB search
MQGYITRGRLQVAEQLDNFINEQALPGTGVDRDTFWQGAETLFEKFIPQNRALLEKREQL
QRAIDDYHKAGNPVNGNEYTDFLKNIGYLVEQPSQVSAQTKNVDAEIATMAGPQLVVPIN
NARYALNAVNARWGSLYDALYGTDVISNEGGADAGKSYNPVRGAKVVAKAKDYLDRMIPL
AKGSHADVTEYKIESGKLAITLVDGDETTLANTEQWQGYQGDISAPSSLLFAHNGLHFEI
QLDPTHPIGESDAANVKDVLVEAALTTIMDCEDSVAAVDAEDKTLVYSNWLGLMKGSLSI
EMTKGGKQLVRAMHDDRSYQPSKHASQDKLKDGELVLSGRSLMFVRNVGHLMTNNAMLFD
GEEVPEGIMDGLVTSLIAKHDLLGNSKFKNSREGSIYIVKPKMHGPEEVAFSNALFGAIE
TIIDVPANTLKMGIMDEERRTSINLQACIAEATSRVVFINTGFLDRTGDEIHTSMLAGPF
AEKAALKSMAWIKAYETANVAVGLRCGLSGKAQIGKGMWPIPDEMQNMMTAKIGHPKAGA
NTAWVPSPTAATLHALHYHDVNVFDVQKSLDENFSGLADILTIPLLEDASTLTRESIKRE
IDNNVQGILGYVVRWVHQGVGCSKVPDINNVGLMEDRATLRISSQHIANWLEHGIVSVDQ
VKESLARMAVLVDEQNAGDPEYIPMTPDLDSSIGFLAASDLIFKGKEQPSGYTEPLLHAR
RREMKAKLAAS
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggatatattactagaggccgactacaggttgccgaacaactcgataactttatt
aatgaacaggcacttcccggcacaggcgtagatagagacaccttttggcaaggtgcagaa
accctcttcgaaaaattcattcctcaaaatcgcgcgctattagaaaagcgagaacagctt
cagcgcgctatcgacgattaccataaagcgggtaacccggtaaacggaaacgaatatacc
gacttcctaaaaaacattggttaccttgttgagcagccgtcacaagtaagtgcacaaaca
aaaaatgtagacgccgaaatagcgacaatggcaggccctcagctagtcgtgccaatcaac
aacgctcgctatgcacttaacgcggtaaacgcccgttggggaagcctttacgacgcacta
tacggcactgatgtcatcagcaatgaaggtggtgcagacgcgggaaaaagctacaacccc
gtacgcggcgccaaagtagttgcgaaagcgaaagactatctagatcgtatgatacccctt
gcgaaaggcagccacgctgacgttactgagtataagattgaatcaggtaaattggcgatc
actcttgtcgacggcgatgaaaccaccttagcgaacacagagcaatggcaaggctaccaa
ggtgacattagcgcaccgtcaagcctgctatttgcacacaacggtctgcattttgaaatt
caactagacccgactcaccccattggcgagagtgatgccgcgaacgtaaaagacgtactg
gttgaagccgcattaaccaccataatggactgcgaagattccgttgctgctgttgacgct
gaagacaaaaccttggtgtatagcaactggttaggcttaatgaaaggctcgctaagcatt
gaaatgacaaagggcggcaagcagcttgttcgcgctatgcatgacgatagaagctaccag
ccgtctaaacacgcttcacaagacaagctaaaagacggcgaactagtactttctggtcga
agccttatgtttgttagaaacgtgggccaccttatgactaacaatgccatgctctttgac
ggcgaagaagtgccagaggggatcatggacggtttagtcacgtcacttatcgcaaagcat
gatcttttaggaaacagcaagtttaaaaacagccgcgaaggcagtatttatattgttaaa
cctaaaatgcacgggccagaagaagttgcattctctaacgcactgtttggcgctatcgaa
acgattatcgacgttccagccaacacccttaaaatgggcataatggatgaagagcgccgc
acgagcatcaaccttcaagcgtgtattgctgaggccacctcacgtgttgtgtttattaac
acaggtttcttagacagaaccggtgatgaaattcacacctcaatgcttgctgggccattt
gcagaaaaagctgcgcttaagtcgatggcatggattaaggcttatgaaaccgcaaatgtg
gcggtaggccttcgctgcggcctttctggcaaagcgcaaattggtaagggcatgtggcca
atacctgatgaaatgcaaaatatgatgaccgccaaaataggccaccctaaggctggcgct
aatactgcttgggttccctcacctactgctgcaacactgcacgcgcttcattatcacgat
gtaaatgtgtttgacgttcaaaagtcgctagatgaaaactttagtggccttgctgacata
cttaccattccattgttagaagatgcctctactttgacgcgtgagagtattaagcgtgaa
atcgacaataacgttcagggcattttaggctacgttgtacgctgggttcaccaaggcgta
ggctgctcgaaagttccggacatcaacaatgtaggcttgatggaagaccgcgcgaccttg
cgtatttcatcgcagcatatagcgaactggctagagcacggcattgtaagtgtagatcag
gtaaaagagtctttggctcgtatggctgtcttggtagatgagcaaaatgcgggagaccct
gaatatatcccaatgacacctgatttagacagctcaattggcttcttagccgcaagtgac
cttatcttcaaaggcaaagagcaacctagcggttacactgaacctttattacacgcccgt
cgccgcgagatgaaagcgaagcttgcggcgagttag

DBGET integrated database retrieval system