KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_13585Help
Entry
AMBAS45_13585     CDS       T02253                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:amb01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:amb00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:amb00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3166523..3168718
Genome map
AA seq 731 aa AA seqDB search
MQGYITRGRLQVAEQLDNFINEQALPGTGVDRDTFWQGAETLFEKFIPQNRALLEKREQL
QRAIDDYHKAGNPVNGNEYTDFLKNIGYLVEQPSQVSAQTKNVDAEIATMAGPQLVVPIN
NARYALNAVNARWGSLYDALYGTDVISNEGGADAGKSYNPVRGAKVVAKAKDYLDRMIPL
AKGSHADVTEYKIESGKLAITLVDGDETTLANTEQWQGYQGDISAPSSLLFAHNGLHFEI
QLDPTHPIGESDAANVKDVLVEAALTTIMDCEDSVAAVDAEDKTLVYSNWLGLMKGSLSI
EMTKGGKQLVRAMHDDRSYQPSKHASQDKLKDGELVLSGRSLMFVRNVGHLMTNNAMLFD
GEEVPEGIMDGLVTSLIAKHDLLGNSKFKNSREGSIYIVKPKMHGPEEVAFSNALFGAIE
TIIDVPANTLKMGIMDEERRTSINLQACIAEATSRVVFINTGFLDRTGDEIHTSMLAGPF
AEKAALKSMAWIKAYETANVAVGLRCGLSGKAQIGKGMWPIPDEMQNMMTAKIGHPKAGA
NTAWVPSPTAATLHALHYHDVNVFDVQKSLDENFSGLADILTIPLLEDASTLTRESIKRE
IDNNVQGILGYVVRWVHQGVGCSKVPDINNVGLMEDRATLRISSQHIANWLEHGIVSVDQ
VKESLARMAVLVDEQNAGDPEYIPMTPDLDSSIGFLAASDLIFKGKEQPSGYTEPLLHAR
RREMKAKLAAS
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggatatattactagaggccgactacaggttgccgaacaactcgataactttatt
aatgaacaggcacttcccggcacaggcgtagatagagacaccttttggcaaggtgcagaa
accctcttcgaaaaattcattcctcaaaatcgcgcgctattagaaaagcgagaacagctt
cagcgcgctatcgacgattaccataaagcgggtaacccggtaaacggaaacgaatatacc
gacttcctaaaaaacattggttaccttgttgagcagccgtcacaagtaagtgcacaaaca
aaaaatgtagacgccgaaatagcgacaatggcaggccctcagctagtcgtgccaatcaac
aacgctcgctatgcacttaacgcggtaaacgcccgttggggaagcctttacgacgcacta
tacggcactgatgtcatcagcaatgaaggtggtgcagacgcgggaaaaagctacaacccc
gtacgcggcgccaaagtagttgcgaaagcgaaagactatctagatcgtatgatacccctt
gcgaaaggcagccacgctgacgttactgagtataagattgaatcaggtaaattggcgatc
actcttgtcgacggcgatgaaaccaccttagcgaacacagagcaatggcaaggctaccaa
ggtgacattagcgcaccgtcaagcctgctatttgcacacaacggtctgcattttgaaatt
caactagacccgactcaccccattggcgagagtgatgccgcgaacgtaaaagacgtactg
gttgaagccgcattaaccaccataatggactgcgaagattccgttgctgctgttgacgct
gaagacaaaaccttggtgtatagcaactggttaggcttaatgaaaggctcgctaagcatt
gaaatgacaaagggcggcaagcagcttgttcgcgctatgcatgacgatagaagctaccag
ccgtctaaacacgcttcacaagacaagctaaaagacggcgaactagtactttctggtcga
agccttatgtttgttagaaacgtgggccaccttatgactaacaatgccatgctctttgac
ggcgaagaagtgccagaggggatcatggacggtttagtcacgtcacttatcgcaaagcat
gatcttttaggaaacagcaagtttaaaaacagccgcgaaggcagtatttatattgttaaa
cctaaaatgcacgggccagaagaagttgcattctctaacgcactgtttggcgctatcgaa
acgattatcgacgttccagccaacacccttaaaatgggcataatggatgaagagcgccgc
acgagcatcaaccttcaagcgtgtattgctgaggccacctcacgtgttgtgtttattaac
acaggtttcttagacagaaccggtgatgaaattcacacctcaatgcttgctgggccattt
gcagaaaaagctgcgcttaagtcgatggcatggattaaggcttatgaaaccgcaaatgtg
gcggtaggccttcgctgcggcctttctggcaaagcgcaaattggtaagggcatgtggcca
atacctgatgaaatgcaaaatatgatgaccgccaaaataggccaccctaaggctggcgct
aatactgcttgggttccctcacctactgctgcaacactgcacgcgcttcattatcacgat
gtaaatgtgtttgacgttcaaaagtcgctagatgaaaactttagtggccttgctgacata
cttaccattccattgttagaagatgcctctactttgacgcgtgagagtattaagcgtgaa
atcgacaataacgttcagggcattttaggctacgttgtacgctgggttcaccaaggcgta
ggctgctcgaaagttccggacatcaacaatgtaggcttgatggaagaccgcgcgaccttg
cgtatttcatcgcagcatatagcgaactggctagagcacggcattgtaagtgtagatcag
gtaaaagagtctttggctcgtatggctgtcttggtagatgagcaaaatgcgggagaccct
gaatatatcccaatgacacctgatttagacagctcaattggcttcttagccgcaagtgac
cttatcttcaaaggcaaagagcaacctagcggttacactgaacctttattacacgcccgt
cgccgcgagatgaaagcgaagcttgcggcgagttag

DBGET integrated database retrieval system