KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_14465Help
Entry
AMBAS45_14465     CDS       T02253                                 

Definition
sugar kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    AMBAS45_14465
Enzymes [BR:amb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     AMBAS45_14465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3392977..3393873
Genome map
AA seq 298 aa AA seqDB search
MAIINFGSINIDHVYQVDHFVQPGETLASTHYQTLLGGKGANQSIALAQAGADVRHVGSI
HENDASFKQALIKKGVDCRGVKCSEVPSGHAIIQVTPSGENAIVLFGGANQTITTKTVMQ
ALDDTRPSDWVLTQNETSSIEEVLRQAKEKQLKVAFNPAPMSESVKQLPLDCVDLLIVNE
TEAAAITGKEELEDIVTAFKEQWSHSEVIITLGKAGVMMLRKNDVVEVKAFSVDAVDTTA
AGDTFIGYFLSAYSNHTDAKQALRRGCAASAIAVTREGAAQSIPTQKEVDRFLAKHAN
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcaataataaattttggctctataaatattgaccacgtttatcaggtagatcacttt
gtacaacctggtgagacgttggcttctacccattatcaaaccttattaggtggtaagggt
gcaaaccagtctattgctttagcgcaagcaggtgcagacgtaagacacgtcggcagcatt
cacgaaaacgacgcctcatttaaacaagctcttattaagaagggtgttgattgtcgtggc
gtaaagtgctcagaagttccttcaggtcacgcgattatccaagtcacgcctagcggtgaa
aacgccatcgtattatttggtggtgctaaccaaaccattaccacaaaaaccgtaatgcaa
gcgttagacgatacgcgtccttcagattgggtactaacccaaaatgaaacaagcagcatt
gaagaagtacttcgccaagcgaaagaaaagcagcttaaagtagcctttaacccagcgcct
atgagcgagtcggttaagcagcttccgttagactgtgtagatttacttattgtaaatgaa
accgaagctgctgcgattaccggtaaagaagaacttgaagatattgtgacagcgttcaaa
gagcagtggtcacacagcgaagttattattacactgggtaaagcgggtgtaatgatgctg
cgcaaaaacgatgttgtagaagtaaaagcattctctgtagacgcggtagataccaccgca
gctggtgacacctttatcggttatttcctgtctgcatacagcaaccacaccgatgctaaa
caagcattgcgtcgcgggtgtgcagcttcagccattgcggtaacacgcgagggcgcagcg
cagagtattccaacacaaaaagaagtggatcgtttcttagcgaaacacgccaactag

  All links  
No link information was found.   
DBGET integrated database retrieval system