KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_14540Help
Entry
AMBAS45_14540     CDS       T02253                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AMBAS45_14540
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMBAS45_14540
   00020 Citrate cycle (TCA cycle)
    AMBAS45_14540
   00620 Pyruvate metabolism
    AMBAS45_14540
Enzymes [BR:amb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AMBAS45_14540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3411728..3413779)
Genome map
AA seq 683 aa AA seqDB search
MSDIQKIIVPDVGGDEVEVIELCVAVGDNIEADEGVVTVESDKASMDIPAPFEGEIVSLS
VSVGDKIKEGDVIGEMKVANGDSADEGASEENASDESSKEDAPKQEEAPKSESKSEAAPA
ASGSSEVIEVAVPDIGSDDEVDVIDVLVSVGDTIEKEDGLITLETDKATMDVPSTHAGTV
KEVFISTGDKVKEGTVVIKLEVAGSGSSSSESASSDASSEASAPAAQESSKQESSPAASA
GSETIEVAVPDIGEDGEVDVIDVLVSAGDTVEKEDGLITLETDKATMDVPSTHAGTIKEV
FIKAGDKVKQGTLVVKLETSGGSTSSAAEKPAEAPKQEETKQDSQQDETQQASQQEASQG
RSPVPPAPDAKNTGKAHASPSVRRIAREFGVDLTQVNGSGPKNRILKEDVQAYVKAELAK
PRTAAASGSAPVGDNVLQIVPVKPVDHSKFGEVEEQKLSRIQKISGPFLHRNWATIPHVT
QFDEADITEVEEFRKEQNAYHAKIKSGLKITPLVFVMKAVAKALEKYEVFNSSLSDDGES
LIIKKFINIGIAVETPGGLVVPVIRDVNKKGIEQLSQELIETSKKAREGKLKAADMQGGT
FTISSLGGIGGTAFTPIVNAPEVAILGVSKSEMKPKWNGKEFEPRLMVPLSLSYDHRVID
GAVGARFSTEVAANLTDLRRIIL
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatattcaaaagattatcgtacccgacgtaggcggtgacgaagttgaagttatc
gagctatgtgttgccgtaggcgacaacattgaggctgatgaaggcgttgttactgttgaa
agtgacaaggcgtcaatggacatcccagcaccgtttgaaggtgagattgtaagcctgtct
gtatcagtaggcgataaaatcaaagaaggcgatgtgattggtgaaatgaaagttgccaat
ggtgacagtgccgatgaaggcgcgtctgaagaaaacgcttcagatgaatcttctaaagaa
gatgcacctaagcaagaagaagcaccaaaaagcgaaagcaagtcagaagcagcgccagct
gcgtctggcagcagcgaagtgattgaagttgcagtaccggatatcggttctgacgacgaa
gtagacgtaatcgacgtattggtttcagtgggcgacaccattgaaaaagaagatgggcta
attacccttgaaaccgataaagcaaccatggacgttccttcaacacacgcaggtacggtg
aaagaagtattcatcagtactggtgataaagtgaaagaaggtacggtagtgatcaagctt
gaagtagcgggctcaggctcgtcttcaagtgaatcggcgtctagcgatgcttcttctgaa
gcatctgcaccggctgcgcaggaaagttcaaagcaagaatcatcgccagcggcgtctgca
ggtagcgagactatcgaagttgctgtaccagacattggtgaagacggtgaagttgacgtt
atcgatgtacttgtatcagctggcgataccgttgaaaaagaagacggtcttatcacgcta
gaaactgataaggcgaccatggatgtgccttcaacacatgcaggtacgattaaagaggtc
tttatcaaagcgggtgacaaagttaagcaaggcaccttggttgttaagcttgagaccagc
ggtggttcgacttcgagtgcagctgaaaagcctgctgaagcgcctaagcaagaagagact
aaacaagactcacagcaagacgagactcaacaagcgtcacaacaggaagcatcgcaaggt
cgctctcctgtgcctcctgcaccagatgccaagaatacaggtaaagcacatgcttctcct
tccgttcgccgtattgctcgtgagtttggtgtagacctgactcaagttaacggctctggc
cctaaaaaccgtatcttgaaagaagacgttcaagcctatgtgaaagctgagcttgcgaaa
cctcgcacagcagcagcttcaggcagtgcgcctgtgggcgacaacgtacttcaaatcgtg
ccggttaagcctgttgatcacagcaagtttggtgaggttgaagaacaaaagctttctcga
attcaaaagatctctggaccgttcttacaccgtaactgggcgaccatcccgcacgttacg
cagttcgacgaagcagatatcactgaagttgaagaattccgtaaagagcaaaacgcttac
cacgcgaaaattaagtctggtcttaagatcacgccactagtattcgttatgaaagcggta
gcgaaagcccttgagaaatacgaagtattcaactcatcactgtctgacgatggcgagagc
ttaatcattaagaagtttatcaacattggtattgcggttgaaacaccggggggccttgtt
gtacctgttattcgtgacgtgaataagaaaggtattgagcagctgtctcaagagcttatc
gaaacatctaagaaagcccgtgaaggcaagcttaaagcggctgacatgcagggtggaacg
ttcaccatctctagtctaggtggtattggtggcacggcgtttacgcctattgtaaatgca
ccagaagtcgccatattaggtgtgtctaagtctgagatgaagcctaagtggaatggtaaa
gagtttgagccgcgcttaatggtgccgctaagcctgtcatacgaccaccgagtaatcgat
ggtgcggtaggtgcaagattctctactgaggttgctgcaaacctaactgacttacgcaga
atcatactttaa

DBGET integrated database retrieval system