KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_14650Help
Entry
AMBAS45_14650     CDS       T02253                                 

Definition
Two component CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:amb02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:amb02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3434443..3435480)
Genome map
AA seq 345 aa AA seqDB search
MTVKVLIVDDSALMRKLFTQLFEKEGFIVQVARNGEEALTKAVEFEPDCITLDINMPVMD
GMTCLAMLKKLYPCPIIMVSSLTQKGATITLEALALGASDFVLKTGGTVSRDISDLEAPL
INKIHALAKTGKPQRPTIKPPPVVTQKVVRHKTSVPFEVVLVGVSTGGPKKLEHLVANLS
PAFPVPIVISQHMPASFTSALAKRLDGISPLNVVEVNAKMPIKAGNVYLAKGDADLAFSK
IGCEVSARPVPSSPSFLWHPSVDRMVDSALNCYKPLSMLCVQLTGMGCDGVAAMSKAFKE
GATTIAESEATSVVFGMPKELIEAGCASFVLDSPKVASKLNALCR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgacagtaaaagtacttatcgtcgacgattccgcgttaatgcgaaagctgttcacgcaa
ctcttcgagaaagagggctttattgttcaagtcgcacgtaacggcgaagaagcgctaact
aaagctgtagagttcgagccagactgtataacactggacattaatatgccggtaatggat
ggcatgacgtgtctggcgatgctcaagaaactttatccttgtcctattatcatggtgtct
tcgctcacgcaaaagggggccaccattaccttagaggcactcgcgcttggtgcaagtgac
tttgtgttaaaaacagggggcactgtttcgcgggatatttcagatttagaggcgccttta
ataaacaaaattcacgccttagccaaaactggcaaaccacagcgtcctacaattaaaccg
cccccagtcgtgacacaaaaagttgttcgccacaaaacgagcgtaccctttgaagtcgtg
ctggtaggcgtttccactggtggtcccaaaaagcttgaacacctggtagctaacttaagc
cccgcatttccggttcctatcgttatttcacagcacatgccagcctctttcaccagtgcg
ctggctaagcgcttggacggaatcagtccgcttaacgtggttgaggtgaatgcgaagatg
cccataaaggctggcaatgtttatcttgcaaaaggggatgctgatcttgccttctcaaaa
atcggctgtgaagtctcagcgcgccctgtgccatcaagcccaagttttctgtggcatcca
agtgtggatcgtatggtagatagcgcacttaactgctacaagccactttctatgctgtgc
gtacagctgaccggaatggggtgtgatggtgttgccgctatgagcaaagcgtttaaagaa
ggtgcgacaacgatcgcagagagtgaggcgacctcagttgtctttggtatgccaaaagag
cttattgaagcgggttgcgccagcttcgtactagatagtcccaaagtcgcatctaaactg
aatgcgctttgtcgttaa

DBGET integrated database retrieval system