KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_14735Help
Entry
AMBAS45_14735     CDS       T02253                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:amb00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:amb00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3457131..3458696)
Genome map
AA seq 521 aa AA seqDB search
MVVSAFIQSIKALLAKFGVDAPDIRIEGLTLDSREVNTRLAFLAIKGHERDGRDFIPQAI
SLGARVILAQTEDSSAHGQMEMRDHSVIISLYELPQMLSALAAAFYDYPAQKMTTVAVTG
TNGKTSTVQLLTQLKDALGTRSASIGTLGSSVFEGDETQWSNTPAANTTPDAIRMQYLLA
DFVQSEVRHTAFEASSHALVQGRLGTVKTDIAVFTNLTRDHLDYHGTMEEYGKAKRLLLQ
QPGLKAVVLNANDDESKKWDGAADKSITRIWTGIDESGLDGSGDSEYLREHNNPQSRHCF
ATNASYHAGGCSFELVSSWGSAAISLPLFGKFNISNVLSAIGTLLAEGERFDDVVNAVNA
ITPVPGRMEVFPVTGAANLVVDYAHTPDALEKVLLSAKFHTTGKVWCVFGCGGDRDKGKR
PLMGQAAEVGADAIVITTDNSRSESPESIAEDIIAGLKNRELAVSISDREKAIRHCLEHA
HESDIIIVAGKGHEDYQIIGDKKTNYNERVVVARLQQEYSK
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
gtggtagttagtgcctttattcaaagtataaaagctttattggcgaaatttggtgtagac
gccccagatatccgcattgaaggtttaacgctagacagccgagaagtgaatacacgctta
gcgttcttggcaattaagggccacgaacgtgatggtcgagattttataccccaggcaata
agtttaggggcccgtgtaattctggcgcaaactgaagacagtagtgcccatggtcagatg
gaaatgcgtgaccacagcgtcattatctcgctgtatgaattaccacaaatgctctctgca
ttagctgctgcattttacgactaccctgctcagaaaatgacgacggtagcagtgacagga
acaaacggaaaaacctctacagttcaattgcttacccagcttaaggatgcgttaggtaca
cgtagtgcaagcatcggaactctagggagcagtgtgtttgaaggcgatgaaacccagtgg
tcgaacacgccggcagcaaacacgacgcccgatgccatacgtatgcaatatttgttggca
gactttgtgcaaagtgaagtgcgccatacggccttcgaagcaagttctcacgcattggtt
caagggcggcttggtacagtaaaaaccgatatcgctgttttcaccaaccttactcgagat
catctcgattatcacggcacaatggaagagtacggcaaagccaagcgcttgctgcttcag
cagccaggtttaaaggctgtggtattaaacgctaatgatgatgaaagtaagaagtgggat
ggtgcagcagataagtcgattacacgcatctggacaggtatagacgaaagtggtctggat
ggaagcggtgacagtgagtacttgcgagagcataacaatcctcaaagtcgccattgtttc
gccacaaatgcttcttatcatgcaggtggatgtagctttgaattggtgagttcgtgggga
agcgctgctatttcgctgccactattcggaaagttcaatatcagtaatgtattgagtgct
ataggtacgttactcgctgaaggtgagcgttttgatgacgtggttaacgcggtaaatgca
atcacgcctgtacccgggcgaatggaagttttccctgtaacgggtgcggcgaatctagtg
gtggactacgcgcatacgccagacgctctggagaaagtgctgctaagcgccaaattccat
acaacgggcaaagtgtggtgtgtgtttggctgtggcggggacagagacaaaggcaagcga
ccattaatggggcaggctgccgaggttggtgctgacgctattgtgatcaccacagataac
agtcgcagtgaaagccctgaatctatcgccgaggatatcattgcgggtttgaaaaaccgt
gagctggcagtgtctatatctgatcgcgagaaagctattcgtcattgccttgagcatgcg
catgaaagcgacatcatcatcgtggccggaaagggccatgaagattaccaaattatcggt
gacaaaaagactaactataacgaacgtgtagttgtggcgcgactgcaacaggagtacagc
aaatga

DBGET integrated database retrieval system