KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_15050Help
Entry
AMBAS45_15050     CDS       T02253                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AMBAS45_15050
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMBAS45_15050
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AMBAS45_15050
Enzymes [BR:amb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AMBAS45_15050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3529041..3530324)
Genome map
AA seq 427 aa AA seqDB search
MELVNLKDSSDTANFAEAVKRGLGKNQGLYFPEHIPTLDNIGELLEKPFVERSIEVLRAL
IGDELNNGELEEIVQTAFAFGAPVEQVNDNVYCLELFHGPTLAFKDFGGRFMAQTLSRIS
EGKPVTILTATSGDTGAAVAHAFHGIDNINVVILFPKGKISALQEKLFTTLGGNIHTVAV
ESDFDACQSLVKTAFDDPDVREGLHLNSANSINISRLLAQVCYYFEAVSQLPKEKREQLV
ISVPSGNFGNLTAGMIAKAMGLPIKRFIAATNLNDTVPRYLKTGEWAPKATVATMSNAMD
VSQPNNWPRIEALIERGYIDKACLKGEMVDEEYTQLAMRQLAQQGYTSEPHAAIAYRAVS
HDLEDGEIGLFLGTAHPAKFRETVENVLGNPISLPKALADVAGEDSLAVDLPASYDALKQ
HMMDLLK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtggaattggtaaatttaaaagattcatcggacacagcaaattttgctgaagccgttaag
cggggcttaggtaaaaaccaagggctttattttccagagcatattcctaccctagacaat
attggcgagttattggaaaagccttttgtcgagcgcagtattgaagtacttcgcgcgctt
attggcgatgagctgaataatggcgagctagaagaaattgttcaaacggcttttgctttt
ggtgcaccagtcgagcaagtcaacgataacgtctactgcctagagcttttccacggccca
acgcttgcgtttaaagattttggcggccgctttatggcgcaaaccctatcgcgtattagt
gaagggaagccagttaccattctaacagcgacttcaggtgataccggcgcagcggttgca
catgcatttcacggcattgacaatatcaacgtggttattttgtttccaaagggcaagatt
agcgcgctgcaggaaaagctattcactacgctaggcggtaacattcataccgttgctgtt
gagtcagactttgacgcatgccaatcactagtaaaaaccgcgtttgacgaccctgacgta
cgtgaaggccttcacctgaactcagcaaactcaatcaacatcagccgtttattagcccaa
gtgtgctactactttgaagccgtaagtcagttgccaaaagagaagcgcgagcagttagtt
atttcagtacctagcggtaacttcggtaacttaaccgcaggtatgattgctaaagcaatg
gggttgccaattaaacgctttatagcggcaactaacctaaacgatactgtgcctcgctac
cttaaaacgggtgagtgggcgccgaaggcgaccgtggctaccatgtctaacgcaatggac
gttagccagccaaataactggccgcgtattgaggcgcttattgagcgtggctatatcgac
aaagcgtgtcttaaaggtgagatggttgacgaagaatatacgcagcttgctatgcgtcaa
ttggcgcaacaaggctataccagcgagcctcatgccgcgattgcctatcgcgcagtaagt
cacgacttagaagatggtgaaattggtttgttcttaggaacagcgcatccggctaagttc
agagaaaccgttgaaaacgtactaggtaatccaatcagcttaccgaaagcgttggccgat
gtagcaggcgaagacagcttagcggtagacttgccagcgtcttacgatgcacttaagcag
catatgatggatttgcttaagtaa

DBGET integrated database retrieval system