KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_15050Help
Entry
AMBAS45_15050     CDS       T02253                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
amb00260  Glycine, serine and threonine metabolism
amb00750  Vitamin B6 metabolism
amb01100  Metabolic pathways
amb01110  Biosynthesis of secondary metabolites
amb01120  Microbial metabolism in diverse environments
amb01230  Biosynthesis of amino acids
Module
amb_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AMBAS45_15050
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AMBAS45_15050
Enzymes [BR:amb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     AMBAS45_15050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N Trp_DMAT
Motif
Other DBs
NCBI-ProteinID: AFT96473
UniProt: K0EIK7
Position
complement(3529041..3530324)
Genome map
AA seq 427 aa AA seqDB search
MELVNLKDSSDTANFAEAVKRGLGKNQGLYFPEHIPTLDNIGELLEKPFVERSIEVLRAL
IGDELNNGELEEIVQTAFAFGAPVEQVNDNVYCLELFHGPTLAFKDFGGRFMAQTLSRIS
EGKPVTILTATSGDTGAAVAHAFHGIDNINVVILFPKGKISALQEKLFTTLGGNIHTVAV
ESDFDACQSLVKTAFDDPDVREGLHLNSANSINISRLLAQVCYYFEAVSQLPKEKREQLV
ISVPSGNFGNLTAGMIAKAMGLPIKRFIAATNLNDTVPRYLKTGEWAPKATVATMSNAMD
VSQPNNWPRIEALIERGYIDKACLKGEMVDEEYTQLAMRQLAQQGYTSEPHAAIAYRAVS
HDLEDGEIGLFLGTAHPAKFRETVENVLGNPISLPKALADVAGEDSLAVDLPASYDALKQ
HMMDLLK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtggaattggtaaatttaaaagattcatcggacacagcaaattttgctgaagccgttaag
cggggcttaggtaaaaaccaagggctttattttccagagcatattcctaccctagacaat
attggcgagttattggaaaagccttttgtcgagcgcagtattgaagtacttcgcgcgctt
attggcgatgagctgaataatggcgagctagaagaaattgttcaaacggcttttgctttt
ggtgcaccagtcgagcaagtcaacgataacgtctactgcctagagcttttccacggccca
acgcttgcgtttaaagattttggcggccgctttatggcgcaaaccctatcgcgtattagt
gaagggaagccagttaccattctaacagcgacttcaggtgataccggcgcagcggttgca
catgcatttcacggcattgacaatatcaacgtggttattttgtttccaaagggcaagatt
agcgcgctgcaggaaaagctattcactacgctaggcggtaacattcataccgttgctgtt
gagtcagactttgacgcatgccaatcactagtaaaaaccgcgtttgacgaccctgacgta
cgtgaaggccttcacctgaactcagcaaactcaatcaacatcagccgtttattagcccaa
gtgtgctactactttgaagccgtaagtcagttgccaaaagagaagcgcgagcagttagtt
atttcagtacctagcggtaacttcggtaacttaaccgcaggtatgattgctaaagcaatg
gggttgccaattaaacgctttatagcggcaactaacctaaacgatactgtgcctcgctac
cttaaaacgggtgagtgggcgccgaaggcgaccgtggctaccatgtctaacgcaatggac
gttagccagccaaataactggccgcgtattgaggcgcttattgagcgtggctatatcgac
aaagcgtgtcttaaaggtgagatggttgacgaagaatatacgcagcttgctatgcgtcaa
ttggcgcaacaaggctataccagcgagcctcatgccgcgattgcctatcgcgcagtaagt
cacgacttagaagatggtgaaattggtttgttcttaggaacagcgcatccggctaagttc
agagaaaccgttgaaaacgtactaggtaatccaatcagcttaccgaaagcgttggccgat
gtagcaggcgaagacagcttagcggtagacttgccagcgtcttacgatgcacttaagcag
catatgatggatttgcttaagtaa

DBGET integrated database retrieval system