KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_16900Help
Entry
AMBAS45_16900     CDS       T02253                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
amb00010  Glycolysis / Gluconeogenesis
amb00620  Pyruvate metabolism
amb00640  Propanoate metabolism
amb00680  Methane metabolism
amb01100  Metabolic pathways
amb01110  Biosynthesis of secondary metabolites
amb01120  Microbial metabolism in diverse environments
amb01130  Biosynthesis of antibiotics
amb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AMBAS45_16900
   00620 Pyruvate metabolism
    AMBAS45_16900
   00640 Propanoate metabolism
    AMBAS45_16900
  Energy metabolism
   00680 Methane metabolism
    AMBAS45_16900
Enzymes [BR:amb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     AMBAS45_16900
Lipid biosynthesis proteins [BR:amb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   AMBAS45_16900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFT96839
UniProt: K0EKC4
Position
complement(3971285..3973231)
Genome map
AA seq 648 aa AA seqDB search
MTASKTYPVPENILQSTHLTASQYDEMYKQSVEQPEAFWAEHASMLEWYQKPTQIKNTMF
GENDVSIKWFEDGELNASYNCIDRHLADNATKVAYHWEGDSPEDSQDITYQQVHYEVCKL
ANALNEMGVAKGDRVAIYMPMVPEAAYAMLACARIGAVHSVIFGGFSPNAIADRINDSNA
KVVITADEGRRAGRSIPLKANVDKALSGDACPSITHVLVHKLTGGDVDWNAKHDVWWHDA
VDGVSAQCEPEVMNAEDPLFILYTSGSTGTPKGVVHTTGGYLLYSAMTFKYAFDYKEDDV
YWCTADVGWITGHSYMVYGPMVNAASQVFFEGVPTYPDVKRIAQVVEKYKVNSLYTAPTA
IRALMAHGDVPAEGCDVSSLRLLGTVGEPINPEAWEWYHRVIGMSRCPIIDTWWQTETGG
HMILPLPGATELKPGSATRPFFGIQPALFDADGNELEGAAEGNLVIKDSWPSQARTVYGD
HQRFINTYFSAYKGVYFTGDGARCDEDGFYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KVAEAAVVGFPHDIKGQGIYVYVTPNEGVEADEALTKELKAWVRQELSPIATPDMIQWSR
GLPKTRSGKIMRRILRKIAANEHEQLGDTSTLADPSVVDTLIEERLNK
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccagcaaaacttatcctgtgcctgagaacattcttcagtctacacatttaacc
gcatctcaatatgatgagatgtataagcaatctgtagagcaacctgaagcgttttgggct
gagcacgcatctatgcttgagtggtatcaaaagcccacccaaattaaaaacacaatgttt
ggtgaaaacgatgtgtccattaagtggtttgaagatggtgagttaaatgccagctataac
tgtattgatcgccatttagctgataatgccacaaaagtcgcctatcactgggaaggtgac
tcaccagaagatagccaagatatcacgtatcaacaagtgcactatgaagtttgtaaatta
gcgaatgcacttaacgaaatgggcgtagcaaaaggtgatcgtgttgcgatttacatgccg
atggtacctgaggctgcctacgccatgctagcgtgtgcccgaattggtgcagtgcactcg
gtgattttcggtggattttcacctaacgctattgccgatcgtatcaacgacagcaacgcc
aaagtcgtgattactgctgatgaaggccgtcgtgctggaagaagtattcctcttaaagcg
aatgtggataaagcactgtctggtgatgcgtgtccgtctattactcatgttttagttcat
aagctcacaggaggagacgtagactggaatgctaagcacgatgtgtggtggcatgacgct
gttgatggcgtgtcagcgcagtgtgaaccagaggtaatgaacgcggaagacccactgttt
atcctctatacatcaggctctacaggaacgccaaaaggtgtagtacacactacgggcgga
tatctcttatattctgcgatgacctttaaatatgcctttgactacaaagaagacgatgtt
tattggtgtaccgctgatgtcggctggatcacaggccacagctacatggtttatggccca
atggtgaacgccgcatcacaagtgttctttgaaggtgtaccgacctatccagacgttaaa
cgtattgctcaagtagtagaaaaatacaaagtaaatagtttatataccgcgccaactgct
atccgcgcattaatggcccacggagatgttccagctgaagggtgtgatgtctcatcgctt
cgtctgttaggaacagtaggtgagcctattaatcctgaagcatgggaatggtatcaccgc
gtaattggtatgagccgttgtccaatcatcgatacatggtggcagacagaaacaggtgga
cacatgatcctgcctttacctggcgctacggagttgaagcctggctcagcgactcgccca
ttcttcggcattcaacctgcgctatttgatgctgacggtaatgagcttgaaggggcagca
gaaggtaatcttgttattaaagacagctggccgagccaagctcgaacggtttatggcgat
catcagcgctttatcaacacctactttagcgcatacaaaggtgtgtacttcaccggtgat
ggtgctcgttgcgacgaagatggcttttactggatcaccggtcgtgtagatgacgtgcta
aacgtttctggacaccgtttgggtaccgctgaaatcgaaagtgcacttgttgcccatcct
aaagtggctgaggctgccgttgttggcttcccacatgatatcaaagggcagggtatttac
gtttatgtaacgccaaatgaaggggttgaagcagatgaagcccttactaaagagcttaaa
gcgtgggtgcgtcaagagctaagcccgattgctacacctgatatgattcaatggtctcgc
gggctacctaaaactcgctcaggtaaaattatgcgccgtatcttgcgtaagattgccgcc
aatgagcatgagcaattaggtgacacatctacgttggcggatccatcggttgttgataca
ctgatagaggaacgtctaaataagtag

DBGET integrated database retrieval system