KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_17300Help
Entry
AMBAS45_17300     CDS       T02253                                 

Definition
Phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AMBAS45_17300
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    AMBAS45_17300
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    AMBAS45_17300
Enzymes [BR:amb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     AMBAS45_17300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4071154..4072872
Genome map
AA seq 572 aa AA seqDB search
MDRRSFIKLSSLAGASVAVSTGLAGCTVSTSANSQPQTNATFTHGVASGDPLKDAVIIWT
RAVPTANLGSGSGSKSDLAKADILWEMASDADFANVISSGIVEAKAIHDFTVKVDVAGLS
PARRYFYRFKSANNTSPVGETRTLPEVDVSNVTFGIFSCSNYPAGFFTPYMEAAKDDNID
YVLHLGDYIYEYDGEGYATEHAKEIGRTYAPDNDTELYTLTDYRNRYALYRTDEGLLSLH
QNKPFIVVWDDHEITNDTYKDGAENHQADEGDFYARRAAAVQAYYEWLPIRPPFGTERLE
IYRQFTFGKLLDLYMLDTRVLARDKQLEYANYRDAETNAFDQARFMKDIGNPNRGLLGET
QRNWLHSSMRQSQAKWQVLGQQLLIGRMLFPVSIFNGVERKAIPDHVHRLANIKRKQKQG
GALSEQELALINTVMPYNLDAWDGYPVEREQVLMQLKSIGKPVIALAGDTHNAWHNKLTL
KDGTEVGVELATPGVTSPGMEHYLSMGDEKAKTLADDLPLLIEDLQYCNLHQRGFMTLTV
SQDSAKATWHYVDAILTKAGKVVNTHSYEIKA
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggatagaagatcgtttataaagctgtcgtcactcgcaggcgcgagcgtagcagtgtct
acagggctagcaggctgtaccgttagcacttcagcaaacagccaaccgcaaaccaacgct
acctttacccatggtgtggcgagtggagacccattaaaagacgccgtgattatttggacg
cgcgccgtgcccacagcaaatttgggctcaggttcgggctcaaagtcagatttagccaag
gccgatattttatgggaaatggcaagcgatgctgattttgccaatgtaataagtagcggt
attgttgaagccaaagcaatccatgattttaccgtaaaagtggatgtagcaggacttagt
ccagctcgtcgttatttttaccgtttcaaaagcgctaataatacaagccctgttggagaa
acccgtacgctacctgaagtcgatgtgtctaacgtcacgttcggcatattttcttgttcc
aactaccccgctggctttttcacgccttacatggaagcagcgaaagacgacaacatcgac
tatgtattacaccttggtgactacatttatgagtacgatggcgaaggttacgcaactgag
cacgccaaggaaattggcaggacctatgcgcctgataacgacaccgagctttatactctc
actgactatcgcaaccgatatgcgctatatcgtacggatgaaggcttgctgtcgttacat
caaaataagccatttattgttgtgtgggatgatcatgaaattactaacgacacctataaa
gacggtgctgagaatcaccaagcggatgaaggcgatttttatgcccgtcgtgcagcggcc
gtacaagcttattatgagtggctacctatacgcccgccgtttggcaccgagcgcttagaa
atttatcgtcagtttacctttggtaagcttcttgacttatacatgctcgacacccgcgtt
cttgcccgcgacaaacagcttgaatacgccaactatcgcgatgctgaaactaatgcgttt
gaccaagcacgctttatgaaagacatcggcaacccgaaccgcggtttactcggtgaaacc
caacgcaactggctacattcgtctatgcggcaaagccaggctaaatggcaggtgttaggg
caacagctattaataggccgcatgcttttccctgtatctatttttaacggcgttgaacgc
aaagcaatacctgatcatgtacataggctcgcgaatatcaaacgcaaacaaaagcaaggt
ggtgcacttagtgagcaagagcttgcgcttatcaataccgtaatgccttacaacttagac
gcatgggatggctatcctgttgagcgggaacaggtgctgatgcagcttaagtccatcggc
aagccagttattgcccttgcaggtgatacacataacgcttggcataataaattaaccctt
aaagacggcacggaggtgggagttgaacttgccacaccaggcgtgacgtcacccggtatg
gaacattacctaagcatgggggatgaaaaagctaaaacccttgcagacgacctaccgctt
cttatagaagatttgcagtactgtaacctccaccagcgcgggttcatgactttaaccgtt
agccaagatagcgcaaaagcaacgtggcactatgtagatgcgattttgaccaaagcaggc
aaagtggttaatacgcatagctatgagattaaggcatag

DBGET integrated database retrieval system