KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_17730Help
Entry
AMBAS45_17730     CDS       T02253                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AMBAS45_17730
Enzymes [BR:amb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     AMBAS45_17730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4166911..4167408
Genome map
AA seq 165 aa AA seqDB search
MHKEHVYIGVGSNLGDCQGKAQRAFDAIGQIEDTRVLKTSSLYSSKPMGPQDQPDYINAV
CLIETSLKPHGLLKQLQRIELEEGRERKGERWGPRTLDLDILLYGSETIDTADLIIPHYG
MAEREFVMVPLFEIAPNMVMHDGKPISAWVANCSLDGLRRLRSSN
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgcataaagaacatgtgtacattggtgtaggtagcaacctcggcgattgccaaggaaaa
gcccagcgcgcgtttgatgcgataggtcaaatcgaagacacccgcgtacttaaaacctct
tcactttattctagtaaaccgatggggccgcaagaccaacctgactatattaacgcggtg
tgcttaattgagacctcgttaaagccgcacggcttattgaagcagctgcaacgcattgag
ctggaagaaggccgtgagcgcaaaggtgagcgctggggaccacgcacgttggatttggat
attttgttgtacggcagcgaaaccatcgacaccgcagacttaatcattccccattacggc
atggcagaacgcgagttcgttatggtgccgctgtttgaaattgcgcccaatatggttatg
cacgatggcaaacccatttcggcatgggtcgctaactgctcgctggatggacttcgtcgc
ctgcgctcttccaattag

DBGET integrated database retrieval system