KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_18060Help
Entry
AMBAS45_18060     CDS       T02253                                 

Definition
alternative dihydrofolate reductase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:amb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AMBAS45_18060
   00670 One carbon pool by folate
    AMBAS45_18060
Enzymes [BR:amb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     AMBAS45_18060
    1.5.1.-  
     AMBAS45_18060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4245903..4246610
Genome map
AA seq 235 aa AA seqDB search
MNSPVLITGASQRLGLAMANSLLDQGHHVVVTYRTLRPSISMLEDKGATVLQADFSTEAA
IDRAIDEIKAISKTYRAVIHNASDWAQEKDNHDKHSLIERMMLVHAVAPYRINLALEKAL
CDCDAQSDIIHMTDYVQETGSEKHMAYAASKAALHNLTLSFAKKLAPKVKVNSIAPALLM
FNEGDDDTYKQKAIKKSLLELVPGAQEAVKAMNYLLDSDYITGQTLHLNGGRHLK
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
ttgaattcacctgtgttaattacaggcgcaagtcaacgtttaggcttagctatggccaat
agtttacttgaccagggccaccacgttgtcgtgacttatcgaacacttcgtccaagtatt
tcaatgcttgaggataaaggcgctacagtcttacaggcggattttagcactgaggcggct
attgatcgagcaattgatgagattaaggcaatcagtaaaacctatcgagcggtgatccac
aacgcgtcagattgggcgcaagaaaaagataaccatgacaagcatagcttgattgaacga
atgatgttggtccatgctgttgccccataccgcataaacttggcacttgaaaaggctctt
tgtgattgcgacgctcagtctgacattattcatatgactgactacgttcaagaaacaggc
agcgagaaacacatggcctatgcggcaagtaaggcagccctgcacaacctgaccctatca
tttgctaagaagctagcaccaaaggtgaaagtaaatagcattgctccggctttgctaatg
ttcaatgagggtgatgatgatacgtacaagcaaaaggcgataaaaaagtcattgcttgaa
ctcgttcctggggcgcaagaggctgtcaaagctatgaactacttacttgatagcgactac
ataactgggcaaacgcttcatttaaatggagggcgacatctaaaataa

DBGET integrated database retrieval system