KEGG   Alteromonas macleodii Balearic Sea AD45: AMBAS45_19255Help
Entry
AMBAS45_19255     CDS       T02253                                 

Definition
3'-phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
amb  Alteromonas macleodii Balearic Sea AD45
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:amb00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4518811..4519656
Genome map
AA seq 281 aa AA seqDB search
MPDDAHAYLLELAKEIAIEAGEAVLEVYDKGEFDAYQKDDESPVTSADYLANDIINKRLQ
AATPDIPILSEENKHASLEERKHWPRYWLIDPIDGTQEFIARSGDFAVNIALIENNEPTI
GVIFWPPGQSLYYAQKGKGAFKSSPDGDHPISVRKLDDPKNSVVMIAISRRQSREKVLSR
MCAKRVYQTLPLGSCSLKACFIAEGKADVFMRIGITGEWDTGASQCIVSEAGGSIAAANF
EPLTYNQRHSLENPDFVVMGDQRVPWQDVVQYDDFVNPHQH
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgcccgacgacgcccatgcctacctactagaacttgcaaaagaaattgccatcgaagcc
ggtgaagccgtattagaagtatacgataaaggggagtttgacgcttatcaaaaagacgat
gagtctcccgttaccagcgcagattatttggcaaacgatatcatcaacaagcgcttacaa
gccgcgacgcctgatatcccaatcctctcagaggaaaacaaacacgcaagtctagaagag
cgaaagcattggcctcgatactggttaatcgatcccatcgacggaacccaagaattcatt
gctagaagcggtgatttcgcagtaaacattgcgctaatagagaataatgagccgacaata
ggcgttatcttttggccgccagggcagtcgctatattacgcccagaaaggcaaaggtgcg
tttaagtcatcacctgatggcgatcacccaataagcgtacgcaagctagacgaccctaaa
aatagtgtggtgatgattgcaataagccgtcgtcagtcgagagaaaaagtgctcagcaga
atgtgcgccaagcgcgtataccaaacgcttccattgggaagctgttccctgaaagcctgc
tttattgccgaaggaaaagctgatgtgtttatgcgcatcggtattaccggcgaatgggac
actggcgcatcgcaatgcattgtctctgaagcgggtgggagcattgccgccgctaacttc
gaacctcttacctacaatcagcgtcattcgctagagaacccagattttgtggtaatgggc
gatcaaagggtgccatggcaagatgtagtccagtatgatgacttcgtaaacccacatcag
cactag

DBGET integrated database retrieval system