KEGG   Alteromonas macleodii Deep ecotype: MADE_000001023000Help
Entry
MADE_000001023000 CDS       T00747                                 

Definition
phosphoenolpyruvate carboxylase (EC:4.1.1.31)
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MADE_000001023000
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MADE_000001023000
  Energy metabolism
   00680 Methane metabolism
    MADE_000001023000
Enzymes [BR:amc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MADE_000001023000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3820693..3823314
Genome map
AA seq 873 aa AA seqDB search
MQTHYDAELKDTVRYLGKTLGETIKNQLGQEWLDRIEKIRKGGRASYQGDATCSEELKET
FKTMSDSDLLTVGRAFAQFLNLGNIAEQEYNAAMNVDASIDALFKHLDKAELTADKVQDA
VAKLNIDLVLTAHPTEVTRRTLIHKHKELADCLQAVHQASLSDVERKKIETRIADLIAQA
WHTEEIRSVRPTPVDEARWGFSVIENSLWEAVPDFMRELDGRLNEDYDVSLPLDASPVQF
SSWMGGDRDGNPFVTSKVTEQVLLLARKRAAKLFALDLDRLQVELSMYDCNDELRDKVGD
ANEPYRALLRPLVNKFIATRDGIADYLAGKNPDTSNWIESDDELIEPLMLCYQSLIDCGM
QVVANGLLLDTIRRARVFGIHLLRLDVRQDSERHADVFSELTRYLGLGDYAQWSEADKQA
FLLRELGSKRPLFPAQWDASDDVKEVLDTCKVIAKHSKHGFGIYIISMASEPSDVMAVQL
LLQESGVDWPMPVAPLFETLDDLNNSPDVMRKLLSIDWYRGYVKGRQFVMIGYSDSAKDA
GALAAGWAQYQSQEALVAIAEEFDVSLTLFHGRGGTIGRGGLPAHAAIYSQPPGSLEGGF
RVTEQGETIRYKFGMPKLAKRSLGIYASAIIEAMLFPPPAPKEEWRELITTMAAQGRDNY
RATVRHDEEFVPYFRVATPEQELGKLPLGSRPAKRKPQGGIESLRAIPWIFAWAQTRLVL
PSWLGVMRAIDSVKTPENEKVVNEMFSEWPFYRSRLSMLDMVFHKADPRISEAYDERLVP
KELKHFGEALRSELKESISSLLAITGDDDIMKNDPQGKESMEIRAGYLQPLHYLQIELLD
RIRKAGDDAQNTSLERAMMVTIAGIAIGMRNTG
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacacactacgatgctgaactgaaagataccgttcgataccttggtaaaaccctt
ggtgaaacaatcaaaaatcaattaggtcaggagtggctagaccggattgaaaagattcga
aaaggcggccgagcttcttatcagggagacgctacttgtagcgaagaactgaaagaaact
ttcaaaacaatgtctgacagcgatttgcttactgttggtcgtgccttcgcacaattcttg
aacctaggtaatattgccgagcaagaatacaacgcggcaatgaatgttgatgcatctatt
gatgcccttttcaaacacctagataaagcagaacttaccgcagataaagtacaagacgcg
gttgcaaagctgaacatcgaccttgttcttaccgctcaccctactgaagtaacacgccgt
acactcattcacaagcataaagaacttgctgactgtcttcaggcagtgcatcaagcctcg
cttagcgatgttgagcgcaaaaaaattgaaacgcgtattgccgatcttatcgcgcaggcg
tggcacactgaagaaattcgttccgttcgcccgacgcctgttgatgaagcgcgttggggc
ttctcggttattgaaaactcgctatgggaagccgtacctgactttatgcgcgagcttgat
ggccgcttaaacgaagactacgacgtatcgctaccgctagacgcgtcacccgtacaattt
agctcgtggatgggcggcgacagagacggtaacccatttgttacttcaaaagtaactgag
caagtactgctgctggcaagaaaacgtgcagctaaacttttcgcgctagaccttgatcgt
ttgcaagtcgagctatcaatgtacgattgcaacgacgaactacgcgacaaagtaggcgat
gcaaacgaaccgtaccgcgccctacttcgcccgctggtaaacaagtttattgcgactcgc
gatggcattgccgactacttggccggcaagaatccagacacgtctaactggattgaaagc
gacgacgagcttatcgagccgctaatgctttgctaccagtcattaatcgactgcggtatg
caagtagtggcaaacggccttctactagatactatccgtcgtgctcgtgtattcggtatt
caccttcttcgccttgacgtacgtcaagattctgagcgtcacgccgacgtatttagtgag
ctaactcgctacctaggtttaggcgattacgcacagtggagcgaagccgacaagcaagcg
ttcttattacgtgagcttggctcgaaacgtccgttattcccagcgcaatgggatgcatct
gacgatgtaaaagaagtgctagatacctgtaaggtgattgcgaaacacagcaagcacggc
ttcggtatctacattatctctatggcaagtgagccatcggatgtcatggcggttcagctg
cttcttcaagaaagcggtgtagactggccgatgccggtagcaccactatttgaaacgctt
gacgatttgaacaactcaccagatgtaatgcgcaaactcctgtctatcgactggtatcgc
ggttacgtgaagggccgtcagttcgttatgatcggttactctgattcagcgaaagatgca
ggcgcattggctgctggctgggcacagtatcagtcgcaagaagcattggttgccattgca
gaagagttcgacgtaagcctaaccctgttccacggacgtggcggtacgattggtcgtggt
ggattgccagcacatgcggcaatttactcacagcctcctggctcactagaaggcggtttc
cgcgtaacagaacagggcgaaactattcgctataagttcggtatgccaaaactggctaaa
cgcagcctaggtatttacgccagcgccattattgaagccatgttgttcccacctccggca
ccaaaagaagagtggcgtgagcttattaccaccatggcagcgcaaggtcgtgataactac
cgtgcaactgtacgtcacgatgaagagtttgtaccttacttccgcgtggctactccagag
caagagctaggtaaactacctctaggcagccgccctgctaagcgtaaaccacaaggcgga
attgagagcttacgtgctatcccatggatcttcgcttgggcacagacacgtttagtgctg
ccaagctggttgggcgttatgcgcgctattgatagcgtgaagactcctgagaacgagaaa
gtggttaacgagatgttcagcgaatggccgttctatcgttcacgcctttctatgttagac
atggtgttccacaaagctgacccacgcattagcgaagcttatgatgagcgcttggtaccc
aaagaacttaaacactttggtgaagcattgcgtagcgagcttaaagaaagcatctcttca
ctgctggctatcacaggcgatgacgacattatgaagaacgacccgcagggtaaggaatcg
atggagatccgcgcaggataccttcagccgcttcattacctgcaaattgagcttctagat
cgtatccgtaaagccggtgacgatgcgcagaacaccagtctagaacgtgccatgatggtt
accattgccggtattgctatcggcatgcgtaacacgggttaa

DBGET integrated database retrieval system