KEGG   Alteromonas macleodii Deep ecotype: MADE_1000760Help
Entry
MADE_1000760      CDS       T00747                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:amc00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
163390..164031
Genome map
AA seq 213 aa AA seqDB search
MASLLGNLFILAAPSGAGKSSLIKALMEKYEGNETTPMQVSVSHTTRQPRPGEVDGVHYH
FVSREQFEALIEQGVFFEYAEVFGNYYGTSRVTIEQTLHRGIDVFLDIDWQGARQVKKLM
PDTCGIFILPPSLDVLEQRLNNRGQDSEEVIAGRMAQAVAEMSHFSEFDSVIVNDDFATA
LGDLEAIVTAQRLRTMKQQMRHQVLLDELLGSA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactacttggcaatttatttatacttgcagctccttcaggggcgggaaaatct
agccttataaaggcgctaatggaaaagtacgaaggtaatgaaactacgcctatgcaggtg
tcggtatctcataccacgcgtcagcctcgtccgggtgaagtagacggcgtacactaccac
tttgtaagtcgagagcagtttgaagcgcttatcgaacaaggcgtattttttgagtacgca
gaggtgttcggcaattattacggcacatcacgggttaccattgaacaaacccttcaccgc
ggaattgatgtgtttttggatatcgattggcaaggtgctcgccaagtcaaaaagcttatg
ccagatacctgtggtattttcattcttcctccgtcgctagatgttcttgagcagcgttta
aataaccgcggtcaggacagtgaagaagtcattgctgggcgcatggcacaagcggtggcg
gaaatgtcacactttagtgagttcgatagcgtaattgttaacgatgactttgccacagca
ctaggtgacttagaagcgatagtgactgcgcagcgtcttcgtacgatgaaacaacaaatg
cgtcatcaggtgctattggacgaattgcttggtagcgcgtaa

DBGET integrated database retrieval system