KEGG   Alteromonas macleodii Deep ecotype: MADE_1000760Help
Entry
MADE_1000760      CDS       T00747                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MADE_1000760
Enzymes [BR:amc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MADE_1000760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
163390..164031
Genome map
AA seq 213 aa AA seqDB search
MASLLGNLFILAAPSGAGKSSLIKALMEKYEGNETTPMQVSVSHTTRQPRPGEVDGVHYH
FVSREQFEALIEQGVFFEYAEVFGNYYGTSRVTIEQTLHRGIDVFLDIDWQGARQVKKLM
PDTCGIFILPPSLDVLEQRLNNRGQDSEEVIAGRMAQAVAEMSHFSEFDSVIVNDDFATA
LGDLEAIVTAQRLRTMKQQMRHQVLLDELLGSA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactacttggcaatttatttatacttgcagctccttcaggggcgggaaaatct
agccttataaaggcgctaatggaaaagtacgaaggtaatgaaactacgcctatgcaggtg
tcggtatctcataccacgcgtcagcctcgtccgggtgaagtagacggcgtacactaccac
tttgtaagtcgagagcagtttgaagcgcttatcgaacaaggcgtattttttgagtacgca
gaggtgttcggcaattattacggcacatcacgggttaccattgaacaaacccttcaccgc
ggaattgatgtgtttttggatatcgattggcaaggtgctcgccaagtcaaaaagcttatg
ccagatacctgtggtattttcattcttcctccgtcgctagatgttcttgagcagcgttta
aataaccgcggtcaggacagtgaagaagtcattgctgggcgcatggcacaagcggtggcg
gaaatgtcacactttagtgagttcgatagcgtaattgttaacgatgactttgccacagca
ctaggtgacttagaagcgatagtgactgcgcagcgtcttcgtacgatgaaacaacaaatg
cgtcatcaggtgctattggacgaattgcttggtagcgcgtaa

DBGET integrated database retrieval system