KEGG   Alteromonas macleodii Deep ecotype: MADE_1001170Help
Entry
MADE_1001170      CDS       T00747                                 

Definition
DNA primase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:amc00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:amc00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(255320..257611)
Genome map
AA seq 763 aa AA seqDB search
MSSSNPPHSSSPFLSEVVPFNQDWQFKKADEALTPEQITQAWENIALPHTPRLEPEVVND
QWQGVAWYQKSFSVPAEWLEQAVLIRFEGAMNATEVWLNDEKVGTHLGGYLPFTLDLSPY
LVLGRNTLRVRLDNRDNDVTGPKPLTLLDFNTYGGLYRDVNLLVKNTLMITDEMHANEVA
GGGVFVTFPFVDKVKSEVNIKTHVANTSGEEKTFTLTQTLSFDGSEVHEVSQQYTLPAGE
KRHFNQLITVAEPALWSPQHPNLYTLDTVLSHGDTTIEHQSRNIGIRSFVFNDKNELLIN
GEKTFLRGVNRHQEYPFVGYATSAQADYRDAVKIKSAGFDYVRLSHYPHSTAFMKAADEL
GLVLLDAILGWQYYNPTKEFEAHTLKACADLLRRDRNHASVIAWECSLNESDMPGEFIAA
LSDTVHAEYPGAYSAGWELGYDIFVQARQHRLQHYETPTVPYIVSEYGDWEYYAQNAGLN
QDSWQDLQEDERTSRQLLNSGEKRLLQQAKNLQEAHNDNFTVPAFADGYWVMFDYNRGYA
DDIEASGIASIYRQPKFSYYFFQSQRNAGEHAPQFESGPMVYIASNWDETSSTNVRVFSN
AERVALYLNDRLIATQSPDTDALSTHLAHPPFTFSIDNFEPGTLRAEALISENIVARHSV
TTPENATALTLRLDTSGIAPTPYVKDKVFIYAQMVDAKGNPVRTNNIELNAEVEGDIKLL
NQSPITTSQGEGALLIEIGETLKNAKITVTAKGLKPATLSLEK
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcttctaatccaccgcattcttcatcgccttttctaagtgaagtagttcctttc
aatcaagactggcagtttaagaaggcggatgaggcgcttacgcctgagcaaataacccaa
gcatgggaaaacattgctcttccacatactccccggttagagcctgaagtggtaaacgac
caatggcaaggtgttgcctggtatcaaaaatcgttttcagtgccggcagaatggcttgag
caagcggtgttgattcgttttgagggcgcaatgaatgctacagaagtttggcttaatgat
gagaaagtgggtactcacttaggtggatatctgccgtttactctcgatttaagcccttac
ctcgtgttaggaaggaataccctccgcgttcgtttagataaccgtgacaatgacgtgact
ggcccgaagccacttacattgcttgattttaatacctacggtggcttatatcgcgatgtt
aatcttctggtaaaaaacaccttgatgattactgatgagatgcacgctaacgaagtagcc
ggtggcggtgtttttgtaaccttcccttttgtagataaagtgaaatctgaagtaaacatt
aaaacgcatgtagctaacaccagcggcgaagaaaaaacgtttacccttacccaaactttg
tcatttgatggaagtgaagttcatgaggtaagccaacaatacaccctgccggcaggtgaa
aagcgtcattttaatcagttaattacagtagctgaacctgccttatggtctcctcagcac
cccaacttatacacactggacactgtattgtcgcatggcgatacaactatagaacatcaa
tcgcgaaacatcggtattcgctcttttgtcttcaatgataaaaatgagctactgataaac
ggtgaaaaaacctttcttcgcggtgtcaaccgccaccaggaatatccgtttgtcggctac
gcaacctctgctcaggctgattaccgcgatgccgtaaaaatcaaatcggcgggtttcgac
tacgttcgattgtcccactaccctcactcaacagcatttatgaaggcggctgacgaactg
ggcttagtattactggatgcaatattgggttggcaatattacaaccccactaaagagttc
gaagctcataccttaaaagcgtgtgctgatttactacgccgagaccgtaatcacgctagc
gtcattgcatgggagtgctcattaaacgaatcagacatgccgggcgaatttatcgcagca
ctatctgatacagtacatgccgaataccctggcgcctattccgcaggatgggaactaggc
tacgatatttttgtacaagcccgtcaacaccgacttcagcattacgaaacacccacagtc
ccttacattgtatctgagtacggggactgggaatattacgcgcaaaacgcgggtttaaat
caggatagctggcaagatttgcaggaagatgagcgtactagccgtcaattactaaatagc
ggtgaaaagcgcctgctgcaacaggcaaagaaccttcaagaagcccacaatgacaacttt
accgtacccgcctttgcagacggttactgggtaatgtttgattataaccgcggctatgcc
gatgacattgaagcttcgggtatcgccagtatttatcgtcagcctaaattcagctattac
tttttccaaagtcaacggaatgcaggcgaacacgccccgcaatttgaaagcggtcccatg
gtgtatatcgcaagtaattgggatgaaacgtcaagcactaatgtgcgcgttttctcaaat
gccgagcgcgtcgcgctttacctcaacgatcgcttaattgcgacgcaaagccccgacact
gatgctttgagtacgcacttagcgcatcctccctttaccttctcaatagataacttcgag
cctggtacattgcgtgctgaagcgctaattagtgagaatattgtcgctcgtcatagtgtc
acaacgccagagaacgccactgcgctaacgctacgactcgacacctcaggtattgctcct
actccctacgtgaaagacaaagtatttatatacgcacaaatggtagatgctaagggcaat
cctgttcgcacaaataacatcgagctgaatgctgaagttgaaggcgatattaaattatta
aatcaaagccccattaccacctctcagggagaaggcgctttattaattgaaattggtgaa
acacttaaaaacgccaaaatcacggttactgccaaaggtctaaaacctgcaacattatca
cttgaaaagtaa

DBGET integrated database retrieval system