KEGG   Alteromonas macleodii Deep ecotype: MADE_1001170Help
Entry
MADE_1001170      CDS       T00747                                 

Definition
DNA primase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MADE_1001170
  Lipid metabolism
   00600 Sphingolipid metabolism
    MADE_1001170
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MADE_1001170
Enzymes [BR:amc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     MADE_1001170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(255320..257611)
Genome map
AA seq 763 aa AA seqDB search
MSSSNPPHSSSPFLSEVVPFNQDWQFKKADEALTPEQITQAWENIALPHTPRLEPEVVND
QWQGVAWYQKSFSVPAEWLEQAVLIRFEGAMNATEVWLNDEKVGTHLGGYLPFTLDLSPY
LVLGRNTLRVRLDNRDNDVTGPKPLTLLDFNTYGGLYRDVNLLVKNTLMITDEMHANEVA
GGGVFVTFPFVDKVKSEVNIKTHVANTSGEEKTFTLTQTLSFDGSEVHEVSQQYTLPAGE
KRHFNQLITVAEPALWSPQHPNLYTLDTVLSHGDTTIEHQSRNIGIRSFVFNDKNELLIN
GEKTFLRGVNRHQEYPFVGYATSAQADYRDAVKIKSAGFDYVRLSHYPHSTAFMKAADEL
GLVLLDAILGWQYYNPTKEFEAHTLKACADLLRRDRNHASVIAWECSLNESDMPGEFIAA
LSDTVHAEYPGAYSAGWELGYDIFVQARQHRLQHYETPTVPYIVSEYGDWEYYAQNAGLN
QDSWQDLQEDERTSRQLLNSGEKRLLQQAKNLQEAHNDNFTVPAFADGYWVMFDYNRGYA
DDIEASGIASIYRQPKFSYYFFQSQRNAGEHAPQFESGPMVYIASNWDETSSTNVRVFSN
AERVALYLNDRLIATQSPDTDALSTHLAHPPFTFSIDNFEPGTLRAEALISENIVARHSV
TTPENATALTLRLDTSGIAPTPYVKDKVFIYAQMVDAKGNPVRTNNIELNAEVEGDIKLL
NQSPITTSQGEGALLIEIGETLKNAKITVTAKGLKPATLSLEK
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcttctaatccaccgcattcttcatcgccttttctaagtgaagtagttcctttc
aatcaagactggcagtttaagaaggcggatgaggcgcttacgcctgagcaaataacccaa
gcatgggaaaacattgctcttccacatactccccggttagagcctgaagtggtaaacgac
caatggcaaggtgttgcctggtatcaaaaatcgttttcagtgccggcagaatggcttgag
caagcggtgttgattcgttttgagggcgcaatgaatgctacagaagtttggcttaatgat
gagaaagtgggtactcacttaggtggatatctgccgtttactctcgatttaagcccttac
ctcgtgttaggaaggaataccctccgcgttcgtttagataaccgtgacaatgacgtgact
ggcccgaagccacttacattgcttgattttaatacctacggtggcttatatcgcgatgtt
aatcttctggtaaaaaacaccttgatgattactgatgagatgcacgctaacgaagtagcc
ggtggcggtgtttttgtaaccttcccttttgtagataaagtgaaatctgaagtaaacatt
aaaacgcatgtagctaacaccagcggcgaagaaaaaacgtttacccttacccaaactttg
tcatttgatggaagtgaagttcatgaggtaagccaacaatacaccctgccggcaggtgaa
aagcgtcattttaatcagttaattacagtagctgaacctgccttatggtctcctcagcac
cccaacttatacacactggacactgtattgtcgcatggcgatacaactatagaacatcaa
tcgcgaaacatcggtattcgctcttttgtcttcaatgataaaaatgagctactgataaac
ggtgaaaaaacctttcttcgcggtgtcaaccgccaccaggaatatccgtttgtcggctac
gcaacctctgctcaggctgattaccgcgatgccgtaaaaatcaaatcggcgggtttcgac
tacgttcgattgtcccactaccctcactcaacagcatttatgaaggcggctgacgaactg
ggcttagtattactggatgcaatattgggttggcaatattacaaccccactaaagagttc
gaagctcataccttaaaagcgtgtgctgatttactacgccgagaccgtaatcacgctagc
gtcattgcatgggagtgctcattaaacgaatcagacatgccgggcgaatttatcgcagca
ctatctgatacagtacatgccgaataccctggcgcctattccgcaggatgggaactaggc
tacgatatttttgtacaagcccgtcaacaccgacttcagcattacgaaacacccacagtc
ccttacattgtatctgagtacggggactgggaatattacgcgcaaaacgcgggtttaaat
caggatagctggcaagatttgcaggaagatgagcgtactagccgtcaattactaaatagc
ggtgaaaagcgcctgctgcaacaggcaaagaaccttcaagaagcccacaatgacaacttt
accgtacccgcctttgcagacggttactgggtaatgtttgattataaccgcggctatgcc
gatgacattgaagcttcgggtatcgccagtatttatcgtcagcctaaattcagctattac
tttttccaaagtcaacggaatgcaggcgaacacgccccgcaatttgaaagcggtcccatg
gtgtatatcgcaagtaattgggatgaaacgtcaagcactaatgtgcgcgttttctcaaat
gccgagcgcgtcgcgctttacctcaacgatcgcttaattgcgacgcaaagccccgacact
gatgctttgagtacgcacttagcgcatcctccctttaccttctcaatagataacttcgag
cctggtacattgcgtgctgaagcgctaattagtgagaatattgtcgctcgtcatagtgtc
acaacgccagagaacgccactgcgctaacgctacgactcgacacctcaggtattgctcct
actccctacgtgaaagacaaagtatttatatacgcacaaatggtagatgctaagggcaat
cctgttcgcacaaataacatcgagctgaatgctgaagttgaaggcgatattaaattatta
aatcaaagccccattaccacctctcagggagaaggcgctttattaattgaaattggtgaa
acacttaaaaacgccaaaatcacggttactgccaaaggtctaaaacctgcaacattatca
cttgaaaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system