KEGG   Alteromonas macleodii Deep ecotype: MADE_1001185Help
Entry
MADE_1001185      CDS       T00747                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:amc00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(260883..262367)
Genome map
AA seq 494 aa AA seqDB search
MGQHILAIDQGTTSSRSIIFSPKRSIDAIAQQEFSQKYPKDGWVEHDPEEIWESVVSTLK
EVFNKCSVAPSDIAAIGITNQRETTLVWDKHSGKPVYNAIVWQDRRTAQYCRDFSEDEAF
VSYITEATGLLLDPYFSATKIAWILDNVEGAREKAENGDLLFGTVDSYLIWRLTGGESHK
TDATNASRTMLFDIHNQCWDEKLLSKFNIPASMLPEVMDCAADFGVIKEEIIGRAIPIQG
VAGDQQAALVGQACFEKGMAKSTYGTGCFMILNTGDAPLQSKNRLLTTVGYRLNGKTTYA
LEGSIFMAGATVQWLRDGLKLIDDAAESEALAQRAREDNGVFLVPAFTGLGAPYWDPDAR
GAILGLTRDTGISEIVAAGLQSVCYQTKDLQKAMESDGARPTTIRVDGGMSRNDWVMGFL
SDILGAEVERPEITETTALGAAFLAGLQAGVFNSIDDLTHCWKSDSVFTPRLTKQERDQA
YDGWKSAVARIRCS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgggacaacatattcttgccattgaccaaggcacaacaagctctcgcagtattattttt
tctccgaaacgcagcattgatgccattgcgcaacaagagttctctcaaaaatatccaaag
gacggctgggtggagcacgatcccgaagagatttgggaaagcgttgtatctactctgaaa
gaagtttttaacaaatgtagtgtcgctccatctgacatcgccgccattggtattaccaac
cagcgcgagacaaccttggtatgggataaacactcaggtaaacccgtatacaatgcaatc
gtgtggcaagacagacgcactgcacaatactgccgtgattttagcgaagacgaggcgttt
gtttcttatataaccgaagcaacagggcttttactcgacccttacttctcggccacgaaa
atcgcatggatattagataacgtggaaggcgcccgcgagaaagcagaaaacggcgatctg
ctctttggcacagtggattcatatcttatttggcgtctaaccggcggtgaatcgcataaa
accgacgcgactaatgcgtcgcgcaccatgttatttgatattcacaaccagtgttgggat
gaaaagctattaagtaaattcaatatccctgcctcaatgttacctgaagttatggattgt
gcagctgacttcggcgttattaaagaagagattattggtagggccatccccatccagggc
gttgcaggcgaccagcaagccgcattggtaggccaagcctgttttgaaaaaggtatggca
aaaagtacctatggaacgggttgctttatgattttaaataccggcgatgcgcccctgcaa
tcaaaaaaccgcttacttaccacggtaggttaccgacttaatggcaaaaccacctatgca
ttagaaggcagtatatttatggctggcgccacggtgcaatggcttcgcgatggcttaaaa
cttatcgacgatgccgctgaatcagaagcacttgcgcagcgtgccagagaagacaatggc
gtgtttctagtacccgcatttactggcctgggcgcgccttattgggatccagacgcgcgt
ggcgcaattttaggtttaacccgcgacacaggcattagcgaaatcgttgcagcgggactt
cagtctgtatgctatcagactaaggacctgcaaaaagcaatggaaagcgatggcgctcgc
cccacaactattcgtgtagatggcggtatgtcgcgtaatgattgggttatgggctttctt
tcagacatattgggcgctgaagtagagcgccctgagattacggaaaccaccgctcttggt
gctgccttcttagcaggattacaggctggtgtcttcaattcaatcgacgatttaacccat
tgttggaagagtgatagcgttttcactccaagattgaccaagcaagaacgtgatcaagcc
tatgacggctggaaatcggctgttgcccgcatccgctgtagctaa

DBGET integrated database retrieval system