KEGG   Alteromonas macleodii Deep ecotype: MADE_1001670Help
Entry
MADE_1001670      CDS       T00747                                 

Definition
Ni/Fe hydrogenase
Orthology
K06282  
hydrogenase small subunit [EC:1.12.99.6]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Nitrotoluene degradation
Microbial metabolism in diverse environments
Class
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:amc00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
367292..368290
Genome map
AA seq 332 aa AA seqDB search
MALPTLNKQLQASGISRRTFLKFCATTASLLALPQSAVADLATALGNARRPSVIWLPFQE
CTGCTEAILRSHAPTLESLIFDHISLDYQHTIMAAAGEQAEDARRAAMNAHKGQYLLLVD
GSVPVGNPGYSTISGMSNVDMLRESAKDAAGIIAIGTCASFGGIPKANPNPTGAVAVSDI
ITDKPIVNISGCPPLPIAITAVLVHYLTFKRFPDLDELQRPLAFFGESIHDRCYRRPFFE
QRKFAKSFDDEGAKNGWCLFELGCKGPETFNACATVKWNQGTSFPIESGHPCLGCSEPDF
WDKSSFYQALGPWEWYKSKPGKGAQKHAGKNS
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggcgctaccaacattaaacaagcagttacaagcgtccggtatctcaagacgcacattt
cttaagttttgcgctacaacggcgtctttactggcattgccgcaaagcgctgttgccgat
ttggcgactgcccttggcaatgcgagaagaccctctgtgatttggttgccctttcaagag
tgcacagggtgtaccgaagcaatattgcgctctcatgctcccacattggaaagccttatt
ttcgatcatatttcgttggattatcagcatacgataatggctgctgcgggagagcaagct
gaagacgctaggcgtgcggcgatgaacgcgcacaaagggcaatatttgttgttggttgat
ggttcggttccggtgggtaacccaggatactcaacgatcagtggcatgagtaatgtcgat
atgctgagagaatcggcaaaagatgctgcgggtattattgccatcggtacctgcgcgtct
tttggcgggatccctaaagcaaacccaaatccgacgggggcagtggcagtaagcgacatt
attacagacaagccaatcgtaaacatttcaggctgtccgccactgcctatcgcgattaca
gctgtgttggttcattacctgacgtttaagcgtttccctgatctcgacgaattacaacgc
ccactcgctttttttggtgaaagcatccatgacagatgttatcgacgcccattttttgaa
caacgtaaatttgcaaaatcgtttgatgatgagggggcaaaaaatgggtggtgtttgttc
gaacttggttgtaaagggcccgaaacctttaacgcatgtgcaacggttaaatggaatcaa
ggcacgagttttcctatcgaatctggccatccgtgtcttggttgctctgagcccgatttc
tgggataaaagcagcttttaccaagccttgggtccatgggagtggtacaaatccaaaccc
ggcaaaggtgcacagaagcatgctgggaaaaactcataa

DBGET integrated database retrieval system