KEGG   Alteromonas mediterranea DE: MADE_1002450Help
Entry
MADE_1002450      CDS       T00747                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
amc  Alteromonas mediterranea DE
Pathway
amc00240  Pyrimidine metabolism
amc00250  Alanine, aspartate and glutamate metabolism
amc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MADE_1002450
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MADE_1002450
Enzymes [BR:amc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     MADE_1002450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: AEA96639
UniProt: F2G6G9
Position
complement(510201..511229)
Genome map
AA seq 342 aa AA seqDB search
MIEKRMSDFTGNHILSVNQFDREAIEKVFSVANSMKPYATRQKRTTVLDGAILGNLFFEP
STRTRVSFGTAFNLLGGEVRETTGMSSSALAKGESLYDTARVLSGYSDIIAMRHPAAGSV
AEFAEGSRVPVINGGDGANEHPTQALLDLFTIKRELEYNGHGIDGLHIAMIGDLRYGRTV
HSLSRLLCLFNNIRFTLISPKELAMPQPIIDAIENAGHQLTITDTLEGNMDADICYQTRI
QEERFPSQEEANKYRGKFRLNQSIYTKHFQSKTVIMHPLPRDSRMEANELDNDLNLNPNL
AIFRQTDNGVLVRMALFALTLGVENLLTKYERDVVWYSNKSK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgattgagaagcgcatgtctgactttaccggtaaccacattctttcggttaatcaattc
gatcgcgaggccattgagaaagtcttctcagttgccaattctatgaagccctatgccacg
cggcaaaagcgcaccacggtgcttgatggcgctattctcggtaaccttttctttgaacct
agcactcgtacccgagtgagtttcgggactgcctttaatctattaggcggcgaggtaaga
gaaactaccggcatgtcgagttcggcgctagcaaaaggggagtcgctttacgatacggca
cgtgtgttaagcggctactccgacattatcgccatgcgccaccccgcggcaggctccgta
gctgagtttgcagaaggcagccgcgtaccggtaatcaatgggggcgacggcgcgaacgag
caccctactcaggcgctgcttgaccttttcacaattaaacgggaattggaatacaatggt
cacggcattgacggtttgcacattgccatgattggggacttaagatacgggcgcacggta
cactctctatcgcgccttttgtgcttgtttaacaatatccgctttacgcttatttcgcca
aaagagctggcgatgccccagcccatcattgatgcgattgaaaatgccggccaccaactt
accattactgacacccttgaagggaatatggatgcagatatctgctatcaaacccgcatt
caggaagagcgctttccatcgcaagaagaagccaacaaataccgtggtaaatttagactt
aatcagtctatttacaccaaacactttcagtcaaagaccgttattatgcatccacttcct
cgcgattcacgtatggaagccaacgaattagataacgatctaaaccttaatccgaacctc
gccatttttaggcaaaccgataacggtgtgcttgtgagaatggcattatttgcattaaca
cttggggtagaaaaccttctcaccaagtacgaacgcgatgtggtttggtacagcaacaag
agtaagtaa

DBGET integrated database retrieval system