KEGG   Alteromonas macleodii Deep ecotype: MADE_1002690Help
Entry
MADE_1002690      CDS       T00747                                 

Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    MADE_1002690
Enzymes [BR:amc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     MADE_1002690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
570223..571191
Genome map
AA seq 322 aa AA seqDB search
MNWAFTSENNLASTFATDINPFWQHSVTQGHFVGKDNITVRYSHCIPKSPRATIVICSGR
IESYLKYKEFIYDLYQNGFAVFILDHRGQGLSDRMTSDPQHGYVAHFDDYVDDFVTFVET
IVKPKHQGPLLLVCHSMGGAIGALTLLRMPKLFSKAVFASPMFGIKPSLPNWLANGLIRT
GLAVNRMKKADSGYFFGQTPYIAFPFALNKLTHSKTRYALFRELYDEEQDIQLGGVTTEW
LAAAHQAMNKIENSAGAITTPTLVLSADDDAIIDNKRQRLVAQRMPNATLEIVPRAYHEL
FTESDDIRERSLTRILDFLTES
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggcgttcacgtctgaaaataacttagctagcacttttgctacagatattaat
cctttttggcagcacagcgtgacgcagggccatttcgtaggaaaagacaatatcacagtg
cgctattcgcattgtattcctaagtcgcctcgcgcaacgattgtgatttgttcagggcgt
attgagtcttacttaaaatacaaagagtttatttacgatctctatcaaaatggctttgcc
gtttttattcttgatcaccgaggtcaaggcctatctgaccgaatgacaagcgacccgcag
catggctatgtagcccacttcgatgattacgtagatgactttgtcacatttgtagaaacc
attgttaagcctaagcatcaagggcctttattgttagtgtgccactcgatgggtggagca
ataggcgcattgactttactgcgcatgccaaagcttttctctaaagccgtatttgcatca
ccgatgtttggcattaagccatcgctgcctaactggctagcaaacgggctaatacgcact
ggccttgcggttaatagaatgaaaaaagccgattcaggctacttcttcgggcagacaccg
tatatcgcctttccatttgcactgaataaactgacgcatagtaaaacccgctacgcacta
ttccgcgaattgtatgacgaagagcaggatatacagctaggcggcgtgaccactgaatgg
ttagcggcagcccaccaggcaatgaataaaattgaaaacagcgctggggccattaccacc
cccacactggtattaagtgccgatgacgatgctattatcgataataagcgccagcgtctt
gtagcgcagcgtatgcctaacgcaacgttagaaattgtacctcgtgcttatcatgagctc
ttcaccgagtctgacgatattcgtgaacgctcgctcacccgcattctcgattttcttaca
gaaagctaa

DBGET integrated database retrieval system