KEGG   Alteromonas macleodii Deep ecotype: MADE_1002840Help
Entry
MADE_1002840      CDS       T00747                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MADE_1002840
Enzymes [BR:amc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     MADE_1002840
Exosome [BR:amc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MADE_1002840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
596967..597977
Genome map
AA seq 336 aa AA seqDB search
MTSSPFPHRRMRRLRAKDALRGLVAEHHLTSDDLIYPVFVLPGDNAREAVPSMPGVERLS
VDLLVEEAANWVKLGIKTLALFPVTPMSLKTECASEAFNPQGLAQQAIRALKKAYPEVML
MSDIALDPFTSHGQDGLLDESGYVMNDETVDVLIKQALSHAEAGADIVAPSDMMDGRIGS
IRNALEEAGHINTCIMAYSAKYASAYYGPFRDAVGSAANIKGGNKKTYQMDPANTNEALH
EIALDIEEGADMVMVKPGMPYLDVVRRCKDEFKVPTFAYQVSGEYAMHQAAFANGWLNED
AVILESLLAFKRAGADGILTYFAPQAAALLAKQNGN
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgacatcttcacctttccctcatcgccgaatgcgcagacttcgtgctaaagatgcattg
cgggggcttgtggcagagcatcacttaacgagtgatgatcttatctaccctgtatttgtg
ttaccgggagacaatgcccgtgaagcagtgccttcaatgccgggtgtggaacgattatct
gtcgaccttcttgtagaggaagcggctaattgggtaaagctaggcatcaaaacccttgcg
ctatttcccgttaccccgatgagccttaaaacagagtgcgctagcgaagcctttaaccca
caagggcttgcacaacaagcaataagagcgcttaaaaaggcgtatccagaggttatgttg
atgtctgatatcgcgctagacccatttacttcacacgggcaagatgggctgcttgatgaa
agcggctatgtgatgaatgacgaaaccgttgacgtgctcataaaacaggcgctctcacat
gctgaagcaggagctgatattgtggccccatcagatatgatggacggccgaataggcagt
attcgcaacgcgcttgaggaagcaggccatattaacacgtgtatcatggcgtattctgcc
aagtatgcctctgcttactacgggccgtttcgcgatgcggtcggttctgcagcgaatatt
aaaggtggcaataaaaagacctatcaaatggaccctgctaataccaatgaagccttgcat
gaaattgcactagatattgaagaaggtgcagacatggttatggtaaaaccgggtatgcct
tatttagacgtggttcgacgatgtaaagatgagttcaaagtgcccacgttcgcttaccaa
gtaagcggggaatacgctatgcaccaagcggcatttgccaatggctggttaaatgaggac
gcggttattttagaatcgttattggcgtttaagcgcgcaggtgcagacggcattctaacg
tacttcgcgccgcaagcggcagcgttacttgccaagcaaaacggtaattaa

DBGET integrated database retrieval system