KEGG   Alteromonas macleodii Deep ecotype: MADE_1002840Help
Entry
MADE_1002840      CDS       T00747                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:amc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
596967..597977
Genome map
AA seq 336 aa AA seqDB search
MTSSPFPHRRMRRLRAKDALRGLVAEHHLTSDDLIYPVFVLPGDNAREAVPSMPGVERLS
VDLLVEEAANWVKLGIKTLALFPVTPMSLKTECASEAFNPQGLAQQAIRALKKAYPEVML
MSDIALDPFTSHGQDGLLDESGYVMNDETVDVLIKQALSHAEAGADIVAPSDMMDGRIGS
IRNALEEAGHINTCIMAYSAKYASAYYGPFRDAVGSAANIKGGNKKTYQMDPANTNEALH
EIALDIEEGADMVMVKPGMPYLDVVRRCKDEFKVPTFAYQVSGEYAMHQAAFANGWLNED
AVILESLLAFKRAGADGILTYFAPQAAALLAKQNGN
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgacatcttcacctttccctcatcgccgaatgcgcagacttcgtgctaaagatgcattg
cgggggcttgtggcagagcatcacttaacgagtgatgatcttatctaccctgtatttgtg
ttaccgggagacaatgcccgtgaagcagtgccttcaatgccgggtgtggaacgattatct
gtcgaccttcttgtagaggaagcggctaattgggtaaagctaggcatcaaaacccttgcg
ctatttcccgttaccccgatgagccttaaaacagagtgcgctagcgaagcctttaaccca
caagggcttgcacaacaagcaataagagcgcttaaaaaggcgtatccagaggttatgttg
atgtctgatatcgcgctagacccatttacttcacacgggcaagatgggctgcttgatgaa
agcggctatgtgatgaatgacgaaaccgttgacgtgctcataaaacaggcgctctcacat
gctgaagcaggagctgatattgtggccccatcagatatgatggacggccgaataggcagt
attcgcaacgcgcttgaggaagcaggccatattaacacgtgtatcatggcgtattctgcc
aagtatgcctctgcttactacgggccgtttcgcgatgcggtcggttctgcagcgaatatt
aaaggtggcaataaaaagacctatcaaatggaccctgctaataccaatgaagccttgcat
gaaattgcactagatattgaagaaggtgcagacatggttatggtaaaaccgggtatgcct
tatttagacgtggttcgacgatgtaaagatgagttcaaagtgcccacgttcgcttaccaa
gtaagcggggaatacgctatgcaccaagcggcatttgccaatggctggttaaatgaggac
gcggttattttagaatcgttattggcgtttaagcgcgcaggtgcagacggcattctaacg
tacttcgcgccgcaagcggcagcgttacttgccaagcaaaacggtaattaa

DBGET integrated database retrieval system