KEGG   Alteromonas macleodii Deep ecotype: MADE_1002965Help
Entry
MADE_1002965      CDS       T00747                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MADE_1002965
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    MADE_1002965
Enzymes [BR:amc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MADE_1002965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
626660..628723
Genome map
AA seq 687 aa AA seqDB search
MLFQQVICKKHVSVMGEIRIALGFLAITFLAGITSAQPLSANAPVNLTTGKSSSIQKGGA
QGGIQQNADSLSTIKAMLGQKIILDFRYFCEDDTPSSQCRTPMTKIPASLLALLSGHNIG
GVILFSENIENTEQLITLNYTMQQHMLKVGKQPLFIAIDQEGGRVARLPSDMLAPFAGNM
AIGATFHQHGSTFAQRVARHIGKTLLPLGINTNFAPSVDINSEPKNPVINVRSFSEHPEQ
VAALGQTFVEAMQGTGVISAIKHFPGHGDTHVDSHSGLPLVSHTRAQAMTGDILPFSNII
RSATPPAMVMSAHIQYPSLDDTKITDKNGKRQIVPATLSKKILTNLLRKQLGYKGLIVTD
ALDMAGITQFFSHEEALVRAFSAGADIALMPFTIRNKTDINAFVKLLDNVAVKLADSALD
TSSESAFLVSSYNRIIEAKQRFTLDGFISKPKVWWLDEANDNALTNNPNSLKNKGIRIEK
ALSEGSVSVLFGKEKLPITSTRWLALMPDAARCLAFEAALAHASSKSTNKPLEFACLPLT
ALPNTQLAMDLLQQAEALIVGNISPLHATYELGGFDLPEHVKRRARETEVMAFSKKIMSA
AKTQNKTVVFAPLRMPYSAQDVKSMTDIAIATFSYAISVSAQGSKEENKDDQKVTSYSLN
ALADVLLGNMAAKGRSPVSLDSLSLQK
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
ttgttattccagcaagttatttgtaaaaaacacgtctctgttatgggggaaatacgtata
gccctaggctttttagcgattacttttttagcgggtataacttctgctcagcccttaagt
gctaacgccccggtcaacttaaccacaggtaagagttcctctattcaaaaagggggcgca
caaggcggtatacagcaaaacgcagatagtcttagcaccatcaaggccatgctgggccaa
aagatcattttagattttcgctatttctgcgaagacgacacaccatcatcgcaatgccgc
acaccaatgacgaaaatccctgcaagtttgctggcactattaagtggtcacaacattggt
ggcgtgattctgttttcagaaaacattgaaaataccgagcagttgataacgctaaattac
actatgcagcagcatatgttgaaagtgggcaagcaaccattatttatcgctatcgatcaa
gagggcggtagggtagcgcgcctgccctcagacatgttagcgccatttgccggtaatatg
gcaattggtgcgacgtttcatcaacatggcagtacttttgcgcaacgcgtggctcgccac
atcggtaaaacgctcttaccccttggtattaacaccaactttgccccatcagttgatata
aacagcgagccgaaaaacccggttataaacgtgcgcagtttttcagaacatccagagcag
gttgctgcgctgggccaaacgtttgttgaagcaatgcaggggacgggcgtgataagtgca
attaagcattttccaggtcatggcgacacgcatgtggatagtcacagcggtcttccactg
gtaagtcatacccgagcacaagcaatgacgggtgatattctgccgttttctaatattatt
agaagtgccacaccgccggccatggtaatgagtgcacacattcagtatccatcgttagac
gataccaaaattacagacaagaacggaaagcgacaaatagttccagcgactttgtcgaag
aagatattaaccaacttgcttcgcaagcaactggggtataaaggtctaattgttactgac
gctctagatatggcgggtattacacagttcttctcgcacgaagaggctttagttcgcgca
tttagtgcgggcgcggatattgcgcttatgcctttcactataagaaataaaacggatata
aatgcgtttgtaaagcttctcgacaatgtagcagtaaaactcgcagatagcgcattagat
acatcatcagaaagcgctttcttggtatcttcatataatcgtattatcgaagcaaaacaa
cggtttacgctagatggttttatttccaagccgaaggtctggtggcttgatgaagcaaac
gacaatgcattgactaataaccctaacagtttaaaaaacaaaggaattagaatagagaaa
gcgctttctgaaggttcggtgtctgtgcttttcggaaaagaaaaactaccgataacatca
acgcgctggttggcgctaatgccggatgcggcgaggtgtttagcatttgaagccgcactt
gcacatgctagttctaaaagcaccaataagcctctagagtttgcttgtttacccctaacc
gcgctacctaacacccaattagctatggacctattacagcaggctgaagctttaatagta
ggtaatattagcccgcttcacgcgacctatgagttaggtgggtttgatctacctgagcat
gtgaagcgacgcgcgcgtgaaactgaggtgatggcatttagtaaaaagataatgtctgct
gcgaaaacacaaaataaaaccgtagtttttgcaccgctacgtatgccgtatagtgcacaa
gatgttaaaagcatgacagatattgctattgccacattcagttatgccattagtgtaagc
gcccaaggtagcaaagaagaaaacaaagacgatcaaaaggttaccagctatagtttgaac
gcactagctgatgttttattaggaaacatggctgctaaaggccgttcacccgtttcgtta
gactcactttcactacaaaagtag

DBGET integrated database retrieval system