KEGG   Alteromonas macleodii Deep ecotype: MADE_1003350Help
Entry
MADE_1003350      CDS       T00747                                 

Definition
diacylglycerol kinase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MADE_1003350
   00670 One carbon pool by folate
    MADE_1003350
Enzymes [BR:amc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     MADE_1003350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
685602..686105
Genome map
AA seq 167 aa AA seqDB search
MKIAMIAAMAQNRIIGVDNDMPWHLPADLKHFKAITLGKAVIMGRKTYQSIGRALPGRPN
IVITNNADYSLSDATVVDSPESALEVAKALSVDSDEIMIIGGGTIYQAFLDKADTLYLTY
IDLSVDGDTQFPDYEAVGTWREVSREENDPDEKNKHAYTFVTLSRDK
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagcaatgattgcagcgatggcccaaaatcgaattattggtgttgataatgac
atgccgtggcatttgccagctgaccttaaacattttaaagcaattactttgggcaaagca
gtaattatggggcgtaagacgtaccagtcgatagggcgcgctttgcctggcaggccaaat
atcgttatcactaacaatgcagactacagcttatctgatgcgaccgtggttgattcgcca
gagtcagcactagaagtggcgaaagcactaagtgttgatagcgacgaaataatgatcatt
ggcggagggactatctatcaggctttcctagataaagctgataccctgtatttgacctac
atcgacctttcggtagacggagacactcagtttccagattatgaagccgtaggaacatgg
cgcgaagtatctcgtgaggaaaacgaccccgatgaaaaaaacaaacatgcttatacgttt
gtcacgcttagtcgagataaatag

DBGET integrated database retrieval system