KEGG   Alteromonas macleodii Deep ecotype: MADE_1003370Help
Entry
MADE_1003370      CDS       T00747                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
amc  Alteromonas macleodii Deep ecotype
Brite
Enzymes [BR:amc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     MADE_1003370 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(688795..689430)
Genome map
AA seq 211 aa AA seqDB search
MRASRKGDALAQLLYNEGIRSQAVLNAIAGTPRESFLPDALKHKAYQNTALPIGQGQTIS
QPYIVAKMTELLLDSPNKPEKVLEIGTGSGYQTAILAQLFAKVFSVERIKTLQFQAKRRM
NQLDLHNIAMKHGDGWKGWASKGPYDAIIVTAAAASLPQDLCDQLKEGGRLIIPVGNEQQ
SLLCIDRIEGELKTSTIESVRFVPLVAGELM
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgagagcttctagaaaaggagacgcgttagcacaactgctttataacgagggaatacgt
tcacaagcagtattaaacgccattgctggtacgccgcgggaaagttttctacccgatgcg
ctgaagcacaaagcttatcaaaatacagcgttaccgataggtcaaggtcaaacgatatcg
caaccttacattgttgctaaaatgactgagttgctgctagatagccccaataagccggaa
aaagtactggaaataggtacgggttctggctatcaaacggctattcttgcgcagcttttt
gccaaggtgttcagcgtcgagcgaattaaaacattgcagtttcaggctaagcgtcgtatg
aatcaacttgaccttcacaatattgcaatgaaacacggcgatggttggaaaggctgggcg
tcgaaaggcccctacgatgccattatcgtaaccgccgcagcggcaagtttaccgcaagat
ttgtgcgatcagctcaaagaaggcgggcggctcattattcccgtaggtaacgagcaacaa
tcgttattgtgtatagacaggattgaaggtgaactaaaaacatctaccattgaatcggta
cgatttgttccccttgtagcaggagagctaatgtga

DBGET integrated database retrieval system