KEGG   Alteromonas macleodii Deep ecotype: MADE_1004010Help
Entry
MADE_1004010      CDS       T00747                                 

Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
amc  Alteromonas macleodii Deep ecotype
Brite
Enzymes [BR:amc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     MADE_1004010
Secretion system [BR:amc02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   MADE_1004010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
864506..865228
Genome map
AA seq 240 aa AA seqDB search
MKAVQKMLLAGAFAVGSLLSISTQAADEAAIRDKLTSMLGLDVETIADSPVSGLVQVSTN
RGLFYVSENGQYLLQARVFNIDEEMRNETELALSGLRKDGVKQMKSSSITFKAENEKYEI
SVFTDITCGYCRKFHNEIDELNDAGITVHYLAFPRSGLNSQNYDDMVSVWCAKDPQKALT
KAKAGSDVASASCKNKVAEQYMLGQKLGVNGTPNIVLPDGSLIPGYQPAKMLAKALAATE
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcagtacagaaaatgttgttagccggcgcctttgccgtaggttctttgttgagc
ataagtacacaggctgcagatgaagccgccattcgcgacaagctaacctcaatgttaggg
ttagacgtggaaacgattgctgattcacccgtttcaggcttggtacaagtctctactaac
cgcgggttattttacgtgagcgaaaacgggcaatatttgcttcaagcgcgggtttttaac
attgatgaagaaatgcgtaacgaaacagagcttgccctatcaggattgcgtaaagacggc
gtaaaacaaatgaagtcgtcgtcaattacgtttaaagcggaaaacgagaagtacgaaatt
agcgtgttcaccgatattacctgcggttattgccgtaaatttcataacgaaattgatgag
ttgaacgatgcgggcattaccgttcattatcttgcctttccccgttctggtttaaacagc
cagaattacgacgatatggtatcggtatggtgtgctaaagatcctcaaaaagcgctgact
aaagcgaaagcggggagcgatgttgcaagcgcaagttgtaaaaacaaggtcgctgaacaa
tatatgctggggcaaaaattaggggtgaacggcacgccaaatattgtgttacctgatggt
tcacttatcccagggtatcaacctgctaaaatgttagcgaaggcattagcagcgacagag
taa

DBGET integrated database retrieval system