KEGG   Alteromonas macleodii Deep ecotype: MADE_1004865Help
Entry
MADE_1004865      CDS       T00747                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalU (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MADE_1004865
   00052 Galactose metabolism
    MADE_1004865
   00500 Starch and sucrose metabolism
    MADE_1004865
   00520 Amino sugar and nucleotide sugar metabolism
    MADE_1004865
Enzymes [BR:amc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MADE_1004865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1050278..1051168
Genome map
AA seq 296 aa AA seqDB search
MSQVKKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSECVAAGLKEIILVTHAS
KNSIENHFDTSFELEATLEKRVKRQLLEEVQSICPKDVTIMHIRQGVANGLGHAVLCARP
LIGDAPFAVVLPDVIIDDVASDPKKDNLADMVAKFNTSRVSQVMVEQVPDEDISKFGIAD
LDGAAIAPGDSAKIHKMVEKPPRDEAPSDLAVVGRYVLSEKIWDLLEFTPPGAGGEVQLT
DAIDALMKLEQVDAYYMKGKSHDCGSKLGYMKANVEYALRHPSLGDEFKEYLATVL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaggttaaaaaagcggtaatccctgtagcaggtcttgggacgcgtatgcttccc
gcaacgaaagctattcctaaggaaatgctgccagttgtcgataagccgctaattcaatat
gtagttagtgaatgtgtcgctgcaggactaaaagaaataattctcgttactcacgcaagt
aagaacagcattgaaaaccatttcgatacgtcttttgaacttgaagcaacgctagaaaag
cgtgttaagcgtcagcttttagaagaagttcagtcaatttgcccgaaagacgtaaccatt
atgcatattcgtcaaggtgtggcgaatggcttgggtcatgccgtgttgtgcgcccgtcct
cttattggtgatgcgccttttgcggtggttcttcctgacgtaattattgacgatgttgcc
agcgaccctaaaaaagataaccttgcagacatggtggcgaagtttaacacaagtcgcgta
agtcaggttatggttgagcaagtaccggatgaagatatctctaaatttggtatcgctgat
ttagatggtgccgcaattgcgccaggcgattctgctaaaattcataaaatggtagaaaag
ccacctcgtgatgaagccccgtcagatctagctgtagtgggcagatacgtgctttctgaa
aagatttgggatctgctagaatttactcctcctggtgctggtggtgaagttcagcttact
gatgccattgatgcgctaatgaagcttgagcaagtggatgcttactacatgaaaggcaag
agccacgactgcggtagtaaactaggctatatgaaggcaaacgtagagtacgcacttcgt
cacccatctttaggcgatgagtttaaagaatacttagctacagtactttaa

DBGET integrated database retrieval system