KEGG   Alteromonas macleodii Deep ecotype: MADE_1006005Help
Entry
MADE_1006005      CDS       T00747                                 

Definition
chemotaxis protein CheY
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:amc02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:amc02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1210683..1211813
Genome map
AA seq 376 aa AA seqDB search
MVFKVLVVDDSTFYRRRVKEILDDDRELEVVGEARNGRDALEKAEALKPDVITMDVEMPV
MDGISAVKAIMEKRPTPILMFSSLTHHGAQATLDALEAGALDFLPKKFEDIAQDRKDASR
LLCTKVRLIARRGIGLKRPSFRATETRKLPDNAPKQAFFKTSGLLSGHKDAAKQPTVSSV
RATGKQYKCLAIGASTGGPVALQKVLSPLPAEFPYPIFLVQHMPGTFTTAFAQRLDSNCN
IKVKEAEHGDIVEPGHAYLAPGGKQMLLETIGANKRIAIVDASASDKVNYKPSVDLTFSS
LAKAYGGDVLGVILTGMGADGKEGCRMLKDKGATIWAQDQDSCVVYGMPQAVAAANISSK
SINIDDISSCVQTEMR
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggtctttaaagtcctagtggtggacgactcgacattttatcgtcgtcgagtaaaagaa
atactcgacgatgatagagagcttgaagttgttggggaagcaagaaacgggcgcgatgcc
ttagaaaaagcagaggcacttaaacctgatgtcataacaatggatgtggaaatgcccgta
atggacggcatttcggcggtaaaggctatcatggaaaaacggcctacgccgatcctcatg
ttctcttcgcttactcatcatggagcgcaagctacactcgatgcactagaagccggtgca
ctcgacttcttgccgaaaaaatttgaagatattgctcaagatagaaaagatgcatcgcgc
ttattatgtactaaagttaggttaatagcgcgtcgaggtattggccttaagcgtccatct
tttagagccacagaaacaagaaagctaccggataacgcacccaagcaggcgttttttaaa
acatcggggttactttctggccataaagacgcggcaaaacagcccaccgtctcatctgta
agggcgacgggaaagcaatataaatgcttggcgataggtgcatctacaggtggtcctgtg
gcgctacaaaaagtgctgtcaccactacctgcagaattcccatatcccatttttcttgtc
caacatatgccgggcacatttaccacggcatttgctcagcgcttagattcaaactgcaat
ataaaagtaaaagaagctgagcatggcgatatagtggagccgggccacgcttatttagcg
ccgggcggtaaacagatgttgttagaaaccataggcgcgaataagcgtatagctattgtc
gatgcaagtgcgagcgacaaggttaattataagcccagcgttgatttaacgttcagctcg
ctggccaaagcctatgggggagatgtattaggcgtcattttgacaggcatgggcgcagac
ggcaaagaagggtgccgcatgctgaaggacaaaggtgcgactatttgggcacaagaccaa
gactcctgtgtggtgtatggcatgccccaagccgtagccgctgctaatatatcaagtaaa
agcattaatattgacgatattagcagttgcgttcaaaccgaaatgcgatag

DBGET integrated database retrieval system