KEGG   Alteromonas macleodii Deep ecotype: MADE_1006695Help
Entry
MADE_1006695      CDS       T00747                                 

Gene name
asnB
Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:amc00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1364571..1366241)
Genome map
AA seq 556 aa AA seqDB search
MCGIFGILDIKTDVSELRTQALDLSKLLRHRGPDWSGIWNNDNTILCHERLAIVDVDTGA
QPLISQNDKQILAVNGEIYNHKQLAADLDEPYPFKTRSDCEVILPLFQQKGVDFIDELEG
MFAFILYDEEQDAYLIARDHIGIIPLYTGYDEHGNFYVSSEMKALAGVCKTISEFPPGHY
LWSKEGKITKYYKRDWMEYDNVKDNTSDLDELRVAFEKAVKSHMMSDVPYAVLLSGGLDS
SLVSAVAAQYVAKRVEDEDKTDAWWPRLHSFAVGLEGAPDLKAAKKVADMIGTVHHEIHF
TIQEGLDAIRDVIFHLETYDTTTIRAATPMYLMTRKIKAMGIKMVLSGEGSDEIFGGYLY
FHKAPNAKEFHEETVRKLDRLHMFDCARANKATSAWGVEARVPFLDKNFIDVAMRLNPQD
KMCLDGKMEKWILRKAFDNGETLPAEVLWRQKEQFGDGVGYSWIDSIRDFVENEVTDQQL
ATAEFRFPVNTPDTKEGYYYRTIFEGYFPQESAARCVPGGKSIACSTAEALEWDESFKNN
ADPSGRSMKDVHAGES
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtattttcggtatccttgatatcaaaaccgatgtgtctgaactcagaacccaa
gccctcgatttatctaaacttttgcgccaccgtggccctgactggtcgggtatctggaat
aatgacaataccattctttgtcacgaaagattggcgattgtcgacgtagacacaggtgcg
cagcctcttatcagccaaaacgataagcaaatccttgcggttaacggcgagatttataac
cacaagcaacttgctgctgacttagatgagccttatccgtttaaaacccgttcagattgt
gaagttattcttcctcttttccagcaaaaaggcgtggatttcattgacgaactagaaggt
atgttcgccttcattctttacgacgaagagcaagatgcctacctgattgcccgcgaccat
atcggaattattccgctctataccggttacgacgagcacggcaacttctacgtatcatct
gaaatgaaggcgctagcaggcgtgtgtaaaacgattagcgaattccctcctggccactat
ctgtggagcaaagaaggtaaaatcactaagtattacaagcgcgactggatggaatacgac
aacgtaaaagacaacaccagcgatttagacgaactacgtgtagcgtttgaaaaagcggtg
aagtctcacatgatgtctgacgtgccgtacgctgtactattatctggcggcttagattca
tctctggtatccgctgttgctgcacagtacgtagcaaagcgtgtagaagatgaagacaaa
accgatgcgtggtggcctcgtttacacagctttgcggtgggtcttgaaggtgcgccagat
ttaaaagcggcgaagaaagtggcggatatgattggtactgttcaccatgaaatccatttc
accattcaagaaggtttagatgccatccgcgatgttatcttccatctagaaacctacgat
acgacaacgattcgtgcagctactcctatgtatctaatgacccgtaagattaaagcgatg
ggtatcaaaatggtactatctggggaaggctcagatgaaatctttggcggctacctgtat
ttccacaaagcaccgaacgcaaaagagttccacgaagaaaccgtacgtaagctagatcgc
ctccacatgttcgactgtgctcgtgctaacaaagcgacctcagcctggggtgtagaagcg
cgcgttcctttcttagataagaacttcattgacgtcgccatgcgcctaaacccacaagac
aagatgtgtcttgacggcaaaatggagaagtggatcttgcgtaaagcatttgataacggc
gagacacttccggcggaagtattgtggcgtcaaaaagaacagtttggtgacggtgtaggt
tactcgtggattgactcaattcgcgatttcgtggaaaacgaagtaacagaccaacagcta
gcaacggccgaattcaggttccctgttaatacgccagacacgaaggaaggttactactac
cgcactatcttcgaagggtactttcctcaagaaagcgcagcgcgttgtgtgcctggcggt
aaatctattgcgtgtagtaccgcagaagcccttgagtgggacgaaagctttaagaacaat
gcagacccttctggtcgctcaatgaaagacgttcacgcgggcgaatcataa

DBGET integrated database retrieval system