KEGG   Alteromonas macleodii Deep ecotype: MADE_1006730Help
Entry
MADE_1006730      CDS       T00747                                 

Definition
3'-5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    MADE_1006730
Enzymes [BR:amc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     MADE_1006730
Transfer RNA biogenesis [BR:amc03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    MADE_1006730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1374356..1375147)
Genome map
AA seq 263 aa AA seqDB search
MTQPINSLAQKVLTIAKEAGDKIMAIYEKDFAIYEKQDTSPLTEADLAAHNVIVNALEAE
SDLPILSEESADISWDERKTWSSYWLVDPLDGTKEFIKKNGEFTVNIALIENGKPTMGVV
YAPALNKSYVGIVGDGAWTEVDGEFTAISARKHDGAEVWKVVGSRSHQSPEIQNLLAQLD
GDTELVAMGSSLKLCLVAEGDAHLYPRLGPTSEWDTGAAHAVALAAGANVTVLDPENPLD
DNADALTYNQKESVLNPFFLVSA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacacagcctattaattctcttgcacagaaagtgctgactatcgctaaagaagcgggc
gataagataatggcgatttacgagaaagattttgccatttacgaaaagcaggataccagc
ccattaactgaagctgaccttgccgcgcacaacgttattgtaaatgcccttgaagcggag
tctgatctgccaatcctttctgaggaatcagcagatatttcgtgggatgagcgcaagacg
tggtcgtcatactggctggttgacccgctagacggcaccaaagagtttattaagaaaaac
ggtgagtttacggtaaacattgcacttatcgaaaacggtaaaccgactatgggcgtagtt
tatgcgccagcactcaacaaaagctacgtaggcattgtgggtgacggtgcatggactgaa
gtagatggtgaattcaccgctatttctgcacgcaagcacgacggtgcagaagtgtggaaa
gtggtaggcagccgttctcaccaaagccctgaaattcaaaatttattggcacagcttgat
ggtgatactgagctagtggcgatgggcagctcactaaagctttgcttagtggccgagggc
gatgcacacctttaccctcgtttaggcccaacgtctgaatgggatacgggtgctgcacat
gcagtcgcattagcggcgggtgcgaacgtgaccgtacttgaccctgaaaatccattagat
gacaacgctgacgctcttacctataaccaaaaagagtctgtgttaaacccctttttcctt
gtgagcgcataa

DBGET integrated database retrieval system