KEGG   Alteromonas macleodii Deep ecotype: MADE_1006820Help
Entry
MADE_1006820      CDS       T00747                                 

Definition
lysophospholipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    MADE_1006820
Enzymes [BR:amc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     MADE_1006820
   3.1.2  Thioester hydrolases
    3.1.2.-  
     MADE_1006820
Lipid biosynthesis proteins [BR:amc01004]
 Fatty acid synthase
  Component type
   MADE_1006820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1526464..1527120)
Genome map
AA seq 218 aa AA seqDB search
MFVKFRYLFAFVLIILIPFQALSDQGEQGDTSEKAVLLILGDSLSAAYGLQQHQGWVSLL
QKMWKDDNIPIDIVNAAVSGETTDGGLARFPRLLDQHTPSHVLIELGGNDGLQGHNINKI
KNNLNSLVNVAKENNAVVFLQEMQIPSNYGRRYTQMFTQNFSKVADEQDIATIPFFLEEI
ALHQELMQNDGIHPNAEAQPLIAKFMDRHLRSLILDVQ
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgttaaatttcgttatttattcgcttttgtacttattattttaataccctttcaa
gcgctatcagatcaaggtgagcaaggtgacacaagcgaaaaggcggttttgcttatttta
ggtgacagtctatctgcggcctacgggttgcagcaacatcaaggctgggtcagtttgtta
caaaagatgtggaaagacgacaacattccgattgatattgtaaatgctgcggtaagtggt
gaaacaacagatggcggattagcgcgctttccgcggttattagatcaacatacgccatcc
catgtactaattgaattaggcggtaacgatgggcttcaagggcataacataaacaaaata
aaaaataacttgaattcattagttaatgtggcgaaagaaaacaatgccgttgtatttctt
caagaaatgcagatcccttcgaattacggtaggcgttacacgcaaatgtttactcaaaac
ttcagcaaagtggctgacgagcaagatatagcaacgattcccttttttcttgaagaaata
gcgcttcatcaagaattaatgcaaaacgatggcattcatcccaacgctgaggcacagcct
ttgattgctaagtttatggacagacacttaagaagtttaattcttgatgttcaataa

DBGET integrated database retrieval system