KEGG   Alteromonas macleodii Deep ecotype: MADE_1006820Help
Entry
MADE_1006820      CDS       T00747                                 

Definition
lysophospholipase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:amc01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1526464..1527120)
Genome map
AA seq 218 aa AA seqDB search
MFVKFRYLFAFVLIILIPFQALSDQGEQGDTSEKAVLLILGDSLSAAYGLQQHQGWVSLL
QKMWKDDNIPIDIVNAAVSGETTDGGLARFPRLLDQHTPSHVLIELGGNDGLQGHNINKI
KNNLNSLVNVAKENNAVVFLQEMQIPSNYGRRYTQMFTQNFSKVADEQDIATIPFFLEEI
ALHQELMQNDGIHPNAEAQPLIAKFMDRHLRSLILDVQ
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
gtgtttgttaaatttcgttatttattcgcttttgtacttattattttaataccctttcaa
gcgctatcagatcaaggtgagcaaggtgacacaagcgaaaaggcggttttgcttatttta
ggtgacagtctatctgcggcctacgggttgcagcaacatcaaggctgggtcagtttgtta
caaaagatgtggaaagacgacaacattccgattgatattgtaaatgctgcggtaagtggt
gaaacaacagatggcggattagcgcgctttccgcggttattagatcaacatacgccatcc
catgtactaattgaattaggcggtaacgatgggcttcaagggcataacataaacaaaata
aaaaataacttgaattcattagttaatgtggcgaaagaaaacaatgccgttgtatttctt
caagaaatgcagatcccttcgaattacggtaggcgttacacgcaaatgtttactcaaaac
ttcagcaaagtggctgacgagcaagatatagcaacgattcccttttttcttgaagaaata
gcgcttcatcaagaattaatgcaaaacgatggcattcatcccaacgctgaggcacagcct
ttgattgctaagtttatggacagacacttaagaagtttaattcttgatgttcaataa

DBGET integrated database retrieval system