KEGG   Alteromonas macleodii Deep ecotype: MADE_1006875Help
Entry
MADE_1006875      CDS       T00747                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:amc01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:amc00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:amc00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1537609..1538418)
Genome map
AA seq 269 aa AA seqDB search
MDRYAQMFTGLDKKNQGAFVPFVMVGDPDLAQSEAIICQLIESGADALELGIPYSDPIAD
GPTIQASAIRALESEVTVADCLSVIARVRAKYPEVPIGLLLYSNLVMAQGIENFYSKARD
AGVDSILVADVPIREAVPFQKAAENTGISQILIAPPNATEETMEKIGEYSEGYTYLLGRA
GVTGAETAANVPASELIERLNKHKAAPALLGFGISTPEQVKSAIDAGAAGAISGSATVNI
IAANLSDSHKMLSELGTFVENMKAATTKG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggacagatatgcacagatgtttacgggccttgataagaaaaaccaaggcgcattcgtg
cccttcgtcatggtgggcgacccagatttagcacagtcagaagctattatctgccagctt
atagaaagcggagcagatgcgctagagctaggcattccttattcagacccgattgctgac
ggcccaaccatccaggcttctgccattcgcgcactagaaagcgaggtgactgtagcggat
tgtttgagtgtaatcgcccgcgttcgagcaaagtaccctgaggtgccaattggcttattg
ctgtatagcaacctggtaatggcgcagggtatcgaaaacttctacagtaaagcgcgtgac
gctggcgtagactcaatactggtggcagacgttccgattcgagaagctgtgcctttccaa
aaagcggctgaaaacaccggtatttcgcaaattttgattgcaccaccgaatgcgactgaa
gaaaccatggaaaagattggcgagtactcagaaggttacacttacctattgggtcgcgca
ggggttacgggggccgaaactgctgcgaatgttccagcttctgagcttatcgagcgtttg
aacaaacacaaggctgcgccggcgctactaggttttggtatctcaacgccggaacaagtc
aaatctgctattgatgccggcgctgcaggtgccatttcaggttcagcgacagtaaatatt
attgccgctaacttatcggacagtcacaaaatgcttagcgagctaggtacatttgttgaa
aacatgaaagcggcgacaactaaggggtaa

DBGET integrated database retrieval system