KEGG   Alteromonas mediterranea DE: MADE_1006885Help
Entry
MADE_1006885      CDS       T00747                                 

Definition
(GenBank) phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
amc  Alteromonas mediterranea DE
Pathway
amc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
amc01100  Metabolic pathways
amc01110  Biosynthesis of secondary metabolites
amc01130  Biosynthesis of antibiotics
amc01230  Biosynthesis of amino acids
Module
amc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MADE_1006885
Enzymes [BR:amc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     MADE_1006885
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     MADE_1006885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI FMN_dh QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AEA97519
UniProt: F2G5U8
Position
complement(1539621..1541030)
Genome map
AA seq 469 aa AA seqDB search
MANVLEKIVADKREEVAERKDALRLESFKADLVPSEKSLFAALSEPNAGFIFECKKASPS
KGLIREKFDLDEILAAYTPYAAGISVLTDEKYFQGKFEYLAYVTERVAQPVLNKDFFVDI
YQVYLARHYNADAVLLMLSVLSDEEYRALADVAHSLSLDILTEVSNEVEMERAIALKANI
IGINNRNLRDLSTDLATTERLVPMLEKASHDYVVISESGIYTHQDVLRLAPISQGFLVGS
ALMAEDDLPRAVKTLVNGGVKVCGLTSIEQAQMAFDEGASFGGLIFAEKSPRCITKAQAH
SITQSVNGAFVGVFVNHDIDEVASLATSLNLFAVQLHGSEDEAYIAALAEKLPKECEIWV
VEGINASSTGALPETVDRHLNNKRVNRVLFDCQVGDAKGGTGESFDWQLLSGIEAKHKLV
LAGGIDADNAADAIATGCGVIDVNSGVETAPGKKSADKLKSLFAACRRY
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggctaatgtgcttgagaaaattgttgcagacaaacgagaggaagtggccgaacgcaaa
gatgcgctaaggctagaaagttttaaagcggatttagttccttcagaaaaaagcctattt
gctgcgcttagcgagcccaacgccggttttatctttgaatgtaagaaagcatcaccatcg
aaagggcttattcgagaaaagttcgatttagatgaaattttagcggcttacactccctac
gctgccggcatttcggtgctaacagacgagaaatactttcaaggaaagtttgaatactta
gcttatgtaacagagcgcgttgcacaacccgtgcttaacaaagacttttttgttgatata
taccaagtgtatttagcgcgtcattacaatgccgacgcagtactacttatgctaagcgtg
cttagcgatgaagaatatcgcgcgctggctgacgtggctcactcgctttcactcgatatt
cttaccgaggtgagcaacgaagtagaaatggaacgtgcaatagcgcttaaggcaaatatt
attggtatcaacaaccgtaatttgcgtgacctttccacggatcttgccaccacagaacgc
ttagtgccgatgctagaaaaagcctcgcacgactacgtggtgatttcagagtctggcatc
tacacccaccaagacgtgctgcgtttagcgcccatatcccaaggtttcttagtgggcagt
gcgttgatggcggaagacgacttaccgcgcgccgtaaaaacgttggtaaatggtggcgtt
aaagtatgcggattaacaagcatcgaacaggcgcaaatggcgtttgacgaaggtgcgagt
tttggcgggctaatcttcgctgaaaagtcaccgcgctgtattactaaagcgcaagcccat
tctataacgcaaagcgtcaacggcgcgtttgtaggggtatttgtaaatcacgatattgac
gaggtagcatcgcttgctacgtcattaaaccttttcgcagtgcagcttcatggtagcgaa
gatgaagcttatatcgctgcgcttgctgaaaagctacctaaagagtgcgaaatctgggta
gttgaagggattaacgcctcctctactggcgcactacctgaaacagtggacagacactta
aacaataaacgagttaaccgcgtacttttcgattgccaagtgggtgatgcgaaaggtggc
accggtgaatcatttgattggcagttgcttagtggcattgaggcaaagcataagttagtg
cttgctggcggtattgatgccgacaacgcagccgacgctatcgctacagggtgcggagtt
atcgatgtaaattcaggcgtagagactgccccaggtaagaaaagtgcagataagcttaag
tcgctgtttgctgcttgccgccgttactaa

DBGET integrated database retrieval system