KEGG   Alteromonas macleodii Deep ecotype: MADE_1007000Help
Entry
MADE_1007000      CDS       T00747                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    MADE_1007000
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    MADE_1007000
Enzymes [BR:amc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     MADE_1007000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1584125..1584892)
Genome map
AA seq 255 aa AA seqDB search
MNRRTVFITGGASGIGLGIAEAMMKQGHHVIIADINEQAAKEAVIKLAHLEGSASAVAVD
VCDAQQVAALPEVLGKHTVDVLINNAGIQHVSRIEDFPADKWQQLINIMLVGPALLTQAF
LPAMREQNYGRIINVGSIHSLVASPYKSAYVAAKHGLLGFSKTIALETGDCDITINTLCP
AYVKTPLVEQQVAAQAKENNLTEEEVITKIMLEPMPKKQFVSVEELADTASFLMSPSARN
ITGQTMVLDGGWTAR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaatagacgcacagtatttattacaggcggtgcaagcggtattggtttggggattgcg
gaagcgatgatgaaacagggtcaccatgtgatcatcgctgacatcaatgaacaggccgcg
aaagaagcagtaattaaacttgcgcatttagagggttcggccagtgcggtggctgttgat
gtgtgtgacgcacaacaagtcgcagctttgccagaagtactgggcaaacacactgtagat
gtactgattaataacgcgggaattcagcacgtttctcgcattgaagattttccagcggat
aaatggcagcagctgattaatattatgctggtaggccccgcccttctgactcaagcattt
ttaccggcaatgcgcgagcaaaactacggccgcattattaatgttggctcaatccattct
ttggtggcctcgccttacaagtctgcctacgtggcagccaaacacgggctgttgggcttt
tcaaaaaccattgcccttgaaaccggtgactgtgatatcactatcaataccctttgcccg
gcctacgtaaaaacaccgcttgtcgagcagcaagttgccgcacaggctaaagagaataat
ttgaccgaagaagaggtgataacaaaaatcatgttagagcccatgcctaaaaagcaattt
gtgagtgttgaagagcttgctgataccgcaagttttttgatgtcgcctagcgcgcgtaat
ataaccgggcaaactatggtgctagatggaggttggaccgcgagataa

DBGET integrated database retrieval system