KEGG   Alteromonas macleodii Deep ecotype: MADE_1007335Help
Entry
MADE_1007335      CDS       T00747                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:amc00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    MADE_1007335
  Metabolism of other amino acids
   00480 Glutathione metabolism
    MADE_1007335
Enzymes [BR:amc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MADE_1007335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2466929..2467483
Genome map
AA seq 184 aa AA seqDB search
MKTKGYAAALLSLSLFTSLSYANECPSVLKFMKRKLNSQETVNLCDEYAGKTLLVVNTAS
YCGYTPQFEGLEALYRNYKDKDFAVLGFPSHDFNQEDSDEGKTAELCELTYGVKFPMFEP
ISVKGDDADPMYRMLKNATGKAPSWNFNKYLIDSSGKQITHYPSSTKPTDAAFIADIEAL
LKSE
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaagactaaaggttatgcggctgccctactttcacttagtttattcacatctttgagc
tacgcgaacgagtgccctagcgtacttaaatttatgaagcgtaaactcaattctcaagaa
accgtaaacttgtgtgacgagtacgcaggaaaaaccttgttggtcgttaacactgcgagt
tattgtggttacacgccccagtttgaaggtttagaagcactttaccgcaactacaaagac
aaagattttgccgtgttgggttttccttctcacgattttaatcaagaagatagcgatgaa
ggtaaaactgctgaattgtgtgaactaacctatggcgttaagttcccgatgtttgagccg
atttctgttaaaggtgacgatgccgaccctatgtaccgtatgcttaaaaacgcgacaggc
aaagccccatcttggaatttcaacaagtaccttattgatagttcagggaaacaaattacc
cactaccctagttcaactaagcccacagatgcagcgtttattgcagatatagaagccttg
cttaaaagcgaatag

DBGET integrated database retrieval system