KEGG   Alteromonas macleodii Deep ecotype: MADE_1007335Help
Entry
MADE_1007335      CDS       T00747                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
amc  Alteromonas macleodii Deep ecotype
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:amc00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:amc00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2466929..2467483
Genome map
AA seq 184 aa AA seqDB search
MKTKGYAAALLSLSLFTSLSYANECPSVLKFMKRKLNSQETVNLCDEYAGKTLLVVNTAS
YCGYTPQFEGLEALYRNYKDKDFAVLGFPSHDFNQEDSDEGKTAELCELTYGVKFPMFEP
ISVKGDDADPMYRMLKNATGKAPSWNFNKYLIDSSGKQITHYPSSTKPTDAAFIADIEAL
LKSE
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaagactaaaggttatgcggctgccctactttcacttagtttattcacatctttgagc
tacgcgaacgagtgccctagcgtacttaaatttatgaagcgtaaactcaattctcaagaa
accgtaaacttgtgtgacgagtacgcaggaaaaaccttgttggtcgttaacactgcgagt
tattgtggttacacgccccagtttgaaggtttagaagcactttaccgcaactacaaagac
aaagattttgccgtgttgggttttccttctcacgattttaatcaagaagatagcgatgaa
ggtaaaactgctgaattgtgtgaactaacctatggcgttaagttcccgatgtttgagccg
atttctgttaaaggtgacgatgccgaccctatgtaccgtatgcttaaaaacgcgacaggc
aaagccccatcttggaatttcaacaagtaccttattgatagttcagggaaacaaattacc
cactaccctagttcaactaagcccacagatgcagcgtttattgcagatatagaagccttg
cttaaaagcgaatag

DBGET integrated database retrieval system